Seattle Republican

Friday, August 6, 1909

Seattle, Washington

8 pages

Page 1
Page 1
Page 2
Page 2
Page 3
Page 3
Page 4
Page 4
Page 5
Page 5
Page 6
Page 6
Page 7
Page 7
Page 8
Page 8
Page text (machine-generated)
THE SEATTLE REPUBLICAN Price One Year, $3.00. Single Copies, 10 Cents. Neither "you did nor I did not" proves very much in an argument, but it seems to us that Gov. Johnson's Johnson vs. Chilberg and the Swedes. "I did not" can be more readily substantiated than President Chilberg's "you did." Last Saturday was Swede day at the ex- position and the Swedes were anxious to have Gov. Johnson of Minnesota present on that occasion, but he had not planned that way and spent the day in Spokane. For the alleged snub President Chilberg says Johnson shall not have any Swede votes in this section when he is a candidate for president of the United States, and Johnson replies, "I do not give a —. The fact of the matter is, so far as the state of Washington is concerned, Johnson, as a Democratic candidate for president, even with Chilberg endorsing him, would have no more show of carrying the state than would William Jennings Bryan or any other man foolish enough to accept the Democratic nomination for president, so that should not disturb Johnson's peace of mind for a single minute. "I came to represent the state on Minnesota day, and not to be present Swede day," came from the governor. In other words, Johnson wants the Swedes to understand that he is an American citizen of the United States and not a citizen of Sweden. Congressman Miles Poindexter, of the Third Congressional district of Washington, it is claimed, on very good authority, is voting Washington Republican Voting Like a Democrat. just like a Democrat, and the Democratic party of that district could not be better represented if it had elected one of its own members to the house of representatives. Poindexter made his campaign on the declaration that he would work against the Cannon administration, and the Republicans had nothing more to expect from him, when he voted against Cannon's re-election. On the tariff and other measures on which the Republican and Democrat parties naturally differ, it is perfectly natural for the Republicans to expect Mr. Poindexter to vote with his party unless he has decided to be a Republican no longer, in which case he should announce that fact immediately, if not sooner. It, however, is wrong for the Republicans to make it impossible for Mr. Poindexter to properly represent his district because he is not a party slave. His constituents, so far as the party in Congress is concerned, are well pleased with him, and if they are not they will have an opportunity to express themselves on the subject when he comes up for re-election, but until that time comes he should at least be given a square deal. That, dear reader, is Tom Fisk, he of much local political fame when Tom Humes, aided by Levi Ankeny's barrel, was endeavoring to run the politics of King Mason County Man Does Not Want Nomination. county. No, he does not live in King county now. but he does live in Mason county, where he has amassed a small sized fortune. It was reported a few days ago by a local paper of that county that so far as the nomination for representative in Congress as a successor to the late Francis W. Cushman, Fisk might be coaxed into the fight, but Fisk himself denies that there could be any inducement whatever brought to bear on him to take even the nomination, to say nothing of getting into the fight for the nomination. "I am doing too well to get back into politics, although I must confess I rather like the game. I am inclined to think that Mason county is most decidedly against the return of Senator Piles. Had Cushman lived, and been a candidate for the senatorship, I believe he would have carried the county practically unanimous. Well, yes, the Hon. John L. Wilson is very strong in Mason county, and if he is a candidate for senator I would not be surprised if he did not sweep the county, but there I go talking politics again, when I promised myself not to say a word to you about politics." Washington State Bar Association met last week an attempt was made to disbar former Supreme Judge Milo A. Root. The investigating committee that looked into the Still in the Limelight. Gordon-Root mix-up, publicly announced that it was morally certain that Judge Root accepted no bribes at the hands of Gordon, or any one else, but was indiscreet in permitting Gordon to write an opinion, and yet the members of the committee declared the opinion was good law and would stand the test of the courts. It is barely possible that other judges have been equally indiscreet, only they were never detected in it. There is no doubt but that Judge Root made a mistake in permitting Gordon to write the opinion, but it occurs to us that he was sufficiently ```markdown ``` SEATTLE. WASHINGTON, FRIDAY, AUGUST 6, 1909 punished for that indiscreetness by voluntarily leaving a position that paid him $6,000 per year and taking up the practice of law without a dollar to start on. Punishment is punishment, and punishment should stop somewhere, and in Root's case it ought to have stopped when he quit the bench. Let him that is without sin cast the first stone. Judge Root's friends are standing by him nobly in this unexpected attack, and we venture the assertion that he will never be disbarred. That was but another demonstration of the intolerant spirit on the part of the whites towards the blacks in the South when Senator Stone, of Missouri, for some alleged snub, felt called upon to strike the porter of a dining car. It was another demonstration of the intolerant spirit common to that section when the justice of the peace discharged the senator and added, he had done no more than he ought to have done under the circumstances. It was or should have been the Negro's right to or not to serve not only Senator Stone, but any one else, and the only redress such person would or should have had was to report the matter to the railroad authorities and have the man discharged. No man has the right to chastise another man by violence because he does not serve him promptly, or not at all. Instead of Senator Stone having grounds against the railroad company, the company should enter a damage suit against him for interfering with its employes. Had the waiter been white instead of black, Senator Stone would not have dared to have struck him, and if he had the entire railroad crew would have raised up in arms against him, and if the railroad company had not have seen to it that he was punihsed a general strike on the system would have been ordered, but he was only a nigger. Social war has broken out among the representatives of the state of New York at the A.-Y.-P. Exposition, and the wife of the secretary is charging Social War that the wife of the executive commissioner is not her social peer, and the wife of the commissioner simply shrugs her shoulders and says "she" does not know what she is talking about. If the husbands of both of these society mad women would send them home, and with the command that they look after their respective households, they would do the state they represent a great favor. Such social disturbances is the most nauseating thing that creeps into the American civilization. There seems to be is creeping into the American civilization. There seems to be a desire to mimic the bowing apes of Europe, and it is money to mimic the peasants of Europe as they should be. New York, however, is a great place for such rot, and these women are simply playing the game in Seattle like it is played at their home. After seeing the city by the "gas light" Rev. Rees, of the First Methodist church of this city, preached last Sunday evening on the subject, Methodist Preacher "What I Saw While Seeing the Sees the City. Town." In a metropolitan city like Seattle one who goes out to see the town can see a great many things, but if Rev. Reese saw some of the things which he related, then Seattle is traveling at a pretty fast gait. "The old tenderloin district was as quietcmfwycmfwycmfwycmfwycmfwypaawawa was almost as quiet as a Sunday school, and I had about concluded that Seattle was an ideal place, but before going home I took in the up-town so-called fashionable places, and there I saw things and persons that if they were put in print it would cause almost as much commotion as did the San Francisco earthquake. As many as 400 women, all apparently under the age of twenty-five, and many of them Sunday school pupils, and the most of them of the '400' of the city, were seen sitting at the cafeteria tables drinking wines and other exciting beverages, and none of them eating, although those places are advertised as eating joints. The escorts of these young and finely dressed women all seemed to be thirty years and over of age. They came and went in a constant stream and vehicles of all kinds awaited them at the doors. That the most, if not all of those young women were being graduated to a life of shame and damnation was very evident, and unless a halt is called, and these so-called fashionable resorts, where intoxicating liquors are the chief things sold, are closed, Seattle will be more vile than even gay Paris." Volume XVI, Number 10. H. R. CAYTON, Publisher A genuine wind fall has come Ellis DeBruler's way and he, with his many friends, are rejoicing over his good fortune. The new federal position Ellis DeBruler of emigration commissioner has been Gets Good Job. created for Seattle and Mr. DeBruler has been named by President Taft for the place. For the past eight years he has been convicting hoboes in the police court, and it can be said, without fear of successful contradiction, that few if any ever escaped. He has twice served the Republicans of the state as chairman of the state central committee. Whether the community is troubled with good or bad times, the attendance at the baseball games seem to never decrease. Just how men can find Baseball Craze time to leave their various business enterprises and spend one afternoon after another at a baseball game is more than the average man can explain, and yet they do. The directors of the Seattle Baseball Park have a bonanza this year all but the equal of the A.-Y.-P. exposition from a financial standpoint. Unlike the race course, the devotees of the baseball game are compelled to see it to appreciate it, while the race course devotees may remain at home and still bet just as heavily as if they were looking at the ponies go round the circle. Every evening at the close of the baseball game the street cars running near the park are taxed to their limit to care for those desiring to get home, and among the throngs may be seen many of the leading business men of the city. It is not the money that it costs them to attend the games which counts, but the time they take from the business, and they will give nothing else that precious time except the baseball games. It is certainly strange what a great hold the baseball craze has on the American people. The constant clashes between the sheriff and the prosecuting attorney of King county strikes one as being very peculiar coming, as they do, from men supposed to be above the average intelligence. For the good of the common weal it would seem Jarring Officials Continue at Outs. that the sheriff and the prosecuting attorney would get together and talk over their troubles and at least try to attend to the county's business in a common sense way, and not as two men piteously ignorant of the duties devolving on the holding of such positions. As to who is right and who is wrong the public does not give a tinker's dam, but the tax payers do want to see the affairs of the county conducted along the lines of good sense, and they do not want one official to stand in the way of another performing his duty as he should do so. Within the past month the papers have had columns of stuff about the jars between the sheriff and the county commissioners, and between the sheriff and the prosecuting attorney, all of which should come to an abrupt end or all concerned will show that they are unfit to hold the offices that have been entrusted to them. Suppose it did cost Harry Thaw $325,000 to kill his man, he had the money and he would have put it to no better use than that even if he had not Half Million killed his man. Young Gould did not For His Nec. kill his man, but he married his woman, and it has doubtless cost him ten times as much for his rash act as it has young Thaw for his. The sons of millionaires who amassed fortunes by questionable means usually spend it just as recklessly as they made it, and if Thaw had not spent that amount of money trying to save his neck from the gallows he perhaps would have spent twice as much more in trying to get an opportunity to spend the money for the purpose that he did. It may be Populism, and it may be pessimism, but the laws of this country should be so worded as to make it impossible for one man to pile up such fortunes as hundreds and thousands of them have done, which fortunes are usually spent in riotous living, in corrupting courts or seducing innocent young women to satisfy the damnable lust of such degenerates. The general contract for the Japanese building was awarded to Chase & Company, Seattle, and they sub-let the wiring to Chas. McDonald; the plumbing to L. A. Borde; the sheet metal to Seattle Cornice Works; the Malthoid roofing to the Paraffine Paint company, and the lumber and mill work was divided among different firms. The same firm of contractors built the Chinese Village and the major portion of the materials were supplied by the concerns mentioned above. The sub-contracts for work and materials included: Wiring, Charles McDonald; plumbing, M. Maek; roofing, Paraffine Paint company; lights, Seattle Electric company; lumber, Pacific Lumber & Timber company. ```markdown ``` 图 A HARD JOB. Wanting to go where you are not wanted is frequently said of the American Negro, and Rev. Rees tells a rather laughable story of a colored brother down South who had become imbued with the idea of joining the Episcopal church. He applied to the rector for admission, and the rector knew that if he took him into full membership there would be trouble in the church, so after thinking for a solution to the ugly situation, he suggested to Sambo that he go home and pray over the matter for two weeks, and then let him know what the results were. At the expiration of the two weeks Sambo promptly showed up and was asked by the divine if he had prayed over the proposition and was answered in the affirmative by Sambo. "Well," inquired the rector, "what were the results of your prayers?" "Why de good Lord appeared in a vision and said, 'Sambo, what you want break into dat 'Piscopal church for? I've tried to break in it for de last twenty years and hab neber don so, so I 'spect, passon, I don't want to join your church." A COSMOPOLITAN CONGRE GATION. The membership of the First Methodist Episcopal church of this city is perhaps the most cosmopolitan of that of any any other religious denomination in the Northwest. It was but a few months ago that the writer saw at the communion table Anglo-Saxons, Afro-Americans, Chinese, Japanese and Indians, and they all bowed in humble devotion to their Lord and Master without the one paying any attention whatever to the other. Having such a cosmopolitan membership of course makes the situation to the average white man rather awkward at times. Recently Rev. Reese says he baptized a Brown black baby, and afterward those to whom he was relating the incident failed to unravel the riddle, he said: "I baptized a black baby whose name was Brown." On that occasion some of the members of the organization sat speculating as to whether or not the pastor would kiss the baby when he baptized it, and for a minute or such a matter all eyes were on the pastor. Ignorant of what was in the minds of his white parishioners, he baptized the little innocent, kissed it as fervently as if it were as white as snow, and passed on, giving no sign whatever of having been non plused. There is less prejudice now in that church than there ever was, and there never was any. THE TENTH CAVALRY IN NEW YORK. The New York World, under the caption, "Lest We Forget," says: "New York has never been a city over friendly to the Negro. For that reason alone the reception accorded to the Tenth Regiment United States Cavalry is properly deserving of a place in the annals of the colored race in America. "It is a regiment with a record, and a regiment worth seeing—lean, hard, square shouldered troopers, proud of their officers, proud of their flag and their country, as good soldiers ought to be. Yet the grandfathers and grandmothers of these cavalrymen were slaves; with no rights that the THE CAYTON For Elegantty Furnished Rooms by the Day or Week 2107 EAST JAMES ST. white man was bound to respect. "Forty-six years lie between the draft riots and the crowds that applauded the Tenth Regiment yesterday. It means much to the progress of the Negroes of America that they ave produced such a regiment with such a record. Men who have proved their willingness to die for their country are surely entitled, for themselves and for their people, to the ordinary guarantees of life, liberty and the pursuit of happiness which every American claims as a birthright. They deserve to feel that for themselves, as for every other American, the Republic is opportunity. "When the next great crisis comes in the struggle for human liberty, the city that applauded the Tenth Regiment yesterday may have a keener understanding than it once had of Lincoln's immortal lines: 'And there will be some black men who can remember that with silent tongue and elenched teeth and steady eye and with well poised bayonet they have helped mankind on to this great consummation." GOOD INSTRUCTION. The papers of the central South have given the following instructions to their correspondents: "This paper is getting farther and farther away from printing Negro news. Unless it is a rape story, we want no Negro news by wire, and only brief stories by mail. Ordinary Negro killings have no news value. It is our purpose to encourage Negroes to be law-abiding citizens, and if you come across a news item showing up the better side or humorous side of the Negro, mail it to us." It seems to us that this is as it should be. The Negro needs encouragement just the same as any other race. When a Negro is guilty of a heinous crime, the papers, both North and South, will come out with big headlines and flaunt it to the breeze, but if he is guilty of some meritorious act, it is put down in some corner or not published at all. We do not complain about the big headlines, because that is all right, but why not give the meritorious act the same notice? The white race is judged by its great men, and therefore is a great race. The Negro is judged from the standpoint of its lowest class, hence it is characterized as a degraded race. Why not judge the Negro race from its Booker T. Washington, Fred Douglass, John M. Langston, Vernon, Dabney and a thousand others instead of its lower class. Give them a fair chance. Susie Revels Cayton THE For Elegantty F 2107 The Cayton E.W.WAY & CO. ANCHOR YOUR SAVINGS IN SEATTLE BAILEY BUILDING SEATTLE BEST BOARD COMPANIES REAL ESTATE-INSURANCE THE SEATTLE REPUBLICAN $100,000,000 YEARLY. One of the most serious problems the Department of Agriculture has had to meet is the ridding the country of the millions of rats with which it is infested, and which are especially the foes of the farmer. It is estimated that the rat pest costs the United States $100,000,000 yearly in grain destroyed alone. The rat also pollutes a great quantity of food products which it does not eat, does great damage by digging under buildings and embankments, and gnawing wood, cutting up goods and papers to make nests, killing poultry, and stealing eggs. The most destructive species is the Norway rat, which has been carried to all parts of the world on ships. It is calculated that a single pair of rats would, in three years under favorable circumstances, increase to 20,000,000. The Department of Agriculture has planned a vigorous crusade against the vermin, and it recommends rat-proof construction in buildings, better protection of food supplies, and the use of various poisons in localities haunted by rats. AT SEATTLE THEATRE. Next week, Miss Emma Bunting will positively return to the cast at the Seattle Theatre, making her reappearance as "Bob," in "A Little Outcast." The play was originally produced here at the old Third Avenue Theatre, with little May Stockton in the soubrette lead. Miss Bunting has never had so good a part as "A Little Outcast" during her three long seasons here. The fact that she is unequaled in boy parts will cause her admirers to look forward to next week's play with pleasure. Mr. Si Condit, another Seattle favorite, will direct the stage at the Seattle Theatre after next week, and the fact that Mr. Condit gets better results with melodrama E.W.WA ANCHOR YOUR SAV RAIL BUILT SEAT BEST E COMP REAL ESTATE Phone East 140 CAYURNISHED ROOMS BY THE EAST JAMES Directions: Take James st. Madison st. cable cars, Capital Hill, East Union, Broadway-Pike and transfer to Madrona; off at Twenty-first and East James. than his predecessor, is a guarantee that the future standing at the Seattle Theatre will be better than ever. Miss Emma Bunting has fully recovered from her recent illness, and she will positively appear all next week. "I have made a deep study of social topics, in and out of the pink tea class," said a woman writer, "but I have not arrived at a full understanding of the fascination that clubs exercise over women. By the last reports 3,460 women's clubs are thriving in the United States, with a membership getting near 400,000 women. Women will work like slaves to get a club going and to keep it going. Pretty girls near my home spent an entire day, recently, washing windows and generally fixing up a club house for a leap year dance because the servants had a row with the housekeeper and decamped. Do you think those girls would wash windows and dust chairs at home? Not if the grime of ages accumulated all over the house! Wherein is the charm? Any woman can have a better time at home than at a club and for less money. The desire to ape man seems to be the only explanation." New York Express. The latest "estimate" of the cost of the Panama Canal is $500,000,000. The first was $140,000,000. The last, in our judgment, will approach a billion. But that is not why the government needs money. Eight years under Cleveland cost the country $2,519,524,867; eight years under Roosevelt, $4,627,855,383, a difference of more than two billion dollars. The army and navy, under Cleveland, cost $551,559,393; under Roosevelt, $1,781,426,471, a difference of nearly a billion and a quarter. And fifteen years hence not a single battleship now afloat will be fit to go into action. AY & CO. - SAVINGS IN SEATTLE ILEY DING TTLE BOARD ANIES -INSURANCE M. A. Teister YTON the Day or Week MES ST. The Cayton Scandinavian American Bank. Choice 7 per cent First Mortgages on Improved Seattle Property Made by the bank and containing all the little safeguards that are so often overlooked by the inexperienced investor. Call or write. The Scandinavian-American Bank. Alaska Building, Seattle, Wash. Brooks & Co. 1331 Second Ave., Arcade Bldg. Hatters and Men's Furnishers, Puget Sound National Bank. OF SEATTLE JACOB FURTH .President J. S. GOLDSMITH .Vice-President R. V. ANKENY .Cashier CORRESPONDENTS IN ALL THE PRINCIPAL CITIES OF THE UNITED STATES AND EUROPE DRAFTS ISSUED ON ALASKA AND THE YUKON TERRITORY. Albert Hansen. Eyes Carefully Examined and Properly Fitted With Glasses 706 First Avenue. Phone For a Case of Rainier Beer Delivered to any Part of the City Phone Ind. 5668. Main 5668. W. H. FINCK Pioneer Jeweler and Watch Maker. Our Holiday Specials Unequaled. 816 Second Avenue, Seattle, Wash. Sunset Telephone & Telegraph Co. LOCAL AND LONG DISTANCE CONNECTION Business Office, Third and Spring People's Savings Bank. Edward C. Neufelder, Prest. R. J. Reckle, Vice Presst. Jos. T. Greenleaf, Cashier Incorporated Dec. 19th, 1889. Corporal Savings and Trust General Bank of Brownsville Cor. Second and Pike St. Seattle, Wash. McGraw & Kittinger. Real Estate and Insurance 259 Colman Blk., Phone Main 695 STETSON & POST LUMBER CO. BUILDING MATERIAL Of all kinds. Delivered on short notice. Established 1875. Tel. Main 711 Bonney-Watson Co. UNDERTAKERS Preparing bodies for shipment a specialty. All orders by telephone or telegraph promptly attended to. Telephone Main 13. The Comfort. Newly furnished rooms. Walking distance; rent reasonable; rooms by the day or week. L ISRAEL WALKER. 1101-1103 Jackson Street. Seattle Electric Co. Secure our prices on Electric Fixtures before letting your contract. Latest Designs Exclusively. The Seattle Electric Company, 907 First Ave. ```markdown ``` --- SUMMONS FOR PUBLICATION. IN THE SUPERIOR COURT OF THE State of Washington, in and for King County. James P. Johnson, Plaintiff, vs. Magdalena R. Johnson, Defendant—No. 67539. The State of Washington to the above named defendant, Magdalena R. Johnson. You are hereby summoned to appear within sixty (60) days after the date of first publication of this summons, toowit: within sixty (60) days after the 2d day of July, 1909, and defend the above entitled action in the above en- titled complaint, which has been filed with the plaintiff and serve a copy of your answer upon the undersigned atro- tories for the plaintiff at their office below stated, and in case of your failure so to do, judgment will be rendered against the plaintiff to the demand of the complaint, which has been filed with the clerk of said court. That the object and purpose of said action is to obtain a decree absolutely dis- sving the bonds of matrimony existing within the plaintiff and defendant, the ground of abandonment of the pla- niff by the defendant. McCAFFERTY, ROBINSON & GOD-FREY, Attorneys for Plaintiff. Office Address: 902 Lowman Building, Seattle, King County, Washington. July 2-August 13, 1909. IN THE SUPERIOR COURT OF THE State of Washington, in and for the County of King. Regina B. Groomes, Plaintiff, vs. John Groomes, Defendant.-Summons for Public ation. The State of Washington to the said John Groomes: You are hereby summoned to appear within sixty (60) days after the date of the first publication of this summons, and to appear before the 11th day of June, 1909, and defend the above entitled action in the above entitled court, and answer the complaint of the plaintiff, and serve a copy of your answer upon the undersigned account, and in case of your failure so to do, judgment will be rendered against you according to the demand of the complaint, which has been filed with the clerk of the sale court. The object of this above entitled action is to dissolve the bonds of matrimony now existing between plaintiff and defendant, upon the grounds of abdomen for one year and failure to provide. HERBERT E. SNOOK Attorney for Plaintiff. P. O. Address: 537 Burke Block, Seattle, King County, Washington. June 11, July 23, 1909. IN THE SUPERIOR COURT OF THE State of Washington, for the County of King. Louis N. Musgrave, Plaintiff, vs. Laura A. Musgrave, Defendant. No. The State of Washington to the said Laura A. Musgrave, Defendant: You are hereby summoned to appear within sixty days after the date of the first publication of this summons, to wit, within sixty days after the 18th of June, 2015 and after the 18th of June, 2016 and after the enforced action in the above enforced Court, and answer the complaint of the plaintiff, and serve a copy of your answer upon the undersigned attorney for plaintiff at his office below stated; and in case of your failure so to do, judgment will be rendered against you according to the demand of the Court, addressed with the Clerk of said Court. The object of the said action, set forth in the complaint, is as follows: To obtain a decree of divorce on the grounds of abandonment. HOMER E. TURNER. Attorney for Plaintiff. P. O. address: New York Blk., Seattle, County of King, Washington. June 18—July 30, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. George Michael Schweizer, Marie Wiedemann, Regina Jakobina, Marie Wiedemann, Regina Jakobina, Jacob Schweizer, Christina Kasper, Plaintiffs, vs. Lorenz Schweizer, M. Schultz, agent of Lorenz Schweizer, and the unknown heirs of the said Lorenz Schweizer, if he be deceased, and also all other persons or parties unknown, claiming any the real estate described in the complaint herein. Defendants. No. — Summons by Publication. The State of Washington to the above named defendants Lorenz Schweizer and the unknown heirs of the said Lorenz Schweizer if he be deceased, and also all other persons or parties unknown, claiming any the real estate described in the complaint herein. You, and each of you, are hereby summoned to appear within sixty days after date of the first publication of this summons, to-wit: within sixty days after the entitlement of your son would deline the entitled action, in the above entitled court, and answer the complaint of the plaintiffs herein and serve a copy of your answer upon the undersigned attorney for plaintiffs, at his address, to the notice of the court so to judgment will be rendered against you, and each of you, according to the demand of the complaint herein, which has been filed with the clerk of said court. The object of said action, as set forth in the complaint, is to partition the East forty-four feet of Lots Two (2) and Three (3), Block Two (2), Dean's Addition to the City of Seattle, King County, Washington, between the parties to said action, who are the owners thereof, and the parties to said action, who are the parties to partition can not be made without great prejudice to the owners. EDWARD VON TOBEL Attorney for Plaintiffs Office and Post Office Address: Room 603-5 Mutual Life Bldg. Seattle, King County, Washington. June 18—July 30, 1909. IN THE SUPERIOR COURT OF THE State of Washington for the County of Kling, Jn. Probate In the matter of the estate of Ralph Cook, Deceased. No. $848. Order to sho weause on sale of real estate. Mary Hayes, the executrix of the estate of Ralph Cook, deceased, has filed her petition in this court, duly verified, that the sale of certain real estate of which the said deceased died seized, for the purposes therein set forth; viz.: lot 12, Blk. 1, in Baxter's Add to Seattle, King County, Wash. And it appearing to the court from said petition, that the personal estate of the said deceased in annuity of said executrix is not sufficient to pay the claims against the said estate and the expenses of the administration thereof, and that it is necessary to sell all or a portion of the real estate of the said deceased to pay the said claims of the administration thereof, and that said petition performs to, and is in accordance with the requirements of law in such case made and provided. It is ordered by the court that all persons interested in the estate of the said deceased appear before said Superior Court on the 12th day of April, 1990, to the forementioned for the forementioned of said day at the court room of the Probate Department of said Being an active attorney and from time to time having legal notices for publication, it is perfectly natural for you to want to get acquainted with those newspapers that do your kind of business. THE SEATTLE REPUBLICAN Is just your size in this respect. It already has some notices for publication, as may be seen herein, but it needs more of them, and to that end your business is earnestly solicited. Your notices are promptly called for; handled with care and accuracy. Affidavits delivered without delay. Charges reasonable from a hard times standpoint; everything done in a jam-up manner. TELEPHONE MAIN 305 When you have a publication, and if it happens to be a Divorce Summons or a Notice to Creditors, give us the facts and we will do the rest. THE SEATTLE REPUBLICAN 307 Epler Block. Main 305. Notices Received Up to Friday Noon. Superior Court, in the City of Seattle in said King County, then and there to show cause, if any they have, why an order of this court should not be grunted to said executrix authorizing and employing an employee of said deceased, or so much thereof as may be necessary to pay the aforesaid claims and expenses of administration. It is further ordered that a copy of this order to show cause be published at least four successive weeks before the said 14th day of August, 1904. Seattle Republican, a newspaper printed and published in said County of King and of general circulation therein. Done in open court this 9th day of July, 1909. A. W. FRATER. Judge. FRANK WIESTLING. Attorney for Executrix. 422 Boston Blk., Seattle. July 16-August 13, 1909. IN THE SUPERIOR COURT OF THE State of Washington, for King County, J. W. Brown, Plaintiff, vs. C. E. Chapin, and all persons unknown, if any, having or claiming an interest in and to the hereafter described real property, defendants. No. — Notice and Summons. State of Washington, to the above defendants and each of them: You and each of you, as owners, claimants or holders of an interest or estate in and to the hershafter described real estate, to the above named plaintiff is the holder of one certain delinquent tax certificate, No. B48599, issued by the Treasurer of King County, State of Washington, dated the 11th day of Oct. 1907, for the delinquent taxes of the year 1905, in the property situated in said King County, Wash., described as follows, to-wit: Lot six (6), block seven (7), Hutchinson's Division of Green Lake Addition to the City of Seattle, Wn.; that the taxes for the following prior and subsequent years have been paid by the plaintiff upon said property in the sum of $15.68, 1906-7-8 in the sum of $15.68, including interest to June 22, 1909; that all the taxes and costs of this action to June 23, 1909, aggregate $24.58, which several sums bear interest at the rate of 15 per cent. per annum from said date of payment, and are all the unpaid and unreimbursed taxes upon and against said real property. You and each of you, (including said persons unknown, if any), are hereby further notified and summoned to be and appear within sixty days after the date of publication, and to the clusive of the day of said first publication, to-wit: 60 days after the 23rd day of July, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and have served against the plaintiff undersigned attorney for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien on said taxes against the plaintiff and real property for the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged against the plaintiff as provided by law, and as prayed in plaintiff's complaint, now on file in this cause and court. J. W. BROWN, Plaintiff. J. W. BROWN, Attorney for Plaintiff. Office Address: 314 Northern Bank & Trust Co. Bldg., Seattle, Wn. July 23—Sept. 3, 1909. IN THE SUPERIOR COURT OF THE State of Washington, for King County. J. W. Brown, Plaintiff, vs. Lizzie Roeckh, and all persons unknown, if any, having or claiming an interest in and to the hereafter described real property, defendants. No. — Notice and summons. State of Washington, to the above defendants and each of them: You an investor of an owners, claimant and holders of an interest or estate or in the hereafter described real property, are hereby notified that the above named plaintiff is the holder of the property 48099, issued by the Treasurer of King County, State of Washington, dated the THE SEATTLE REPUBLICAN ATTORNEYS being an active attorney and from time to time giving legal notices for publication, natural for you to want to get with those newspapers that do your k ress. TTLE REPUBLI your size in this respect. It alre notices for publication, as may be s but it needs more of them, and to t business is earnestly solicited. notices are promptly called for; he care and accuracy. Affidavits del out delay. Charges reasonable from standpoint; everything done in a jac r. TEPHONE MAIN 305 in you have a publication, and if it h e a Divorce Summons or a Notice , give us the facts and we will do SEATTLE REPUBLIC Block. Main 30 ices Received Up to Friday Noon City of Seattle, on the 20th day of 1924 19th day of June, 1907, as follows, for the delinquent taxes of 1905, in the amount of $1.60, and upon the real property situated in said King County, described as follows, to-wit: Lot five (5), Block nine (9), Hilliard's Seattle Garden, to the extent that the taxes thereof; that the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, to-wit: 1906-7-8 aggregating $7.75, which with the above tax and $7.75 costs, aggregates June 22, 1909, $17.10, which several sums bear interest, $17.10, which several sums bear interest from said June 22, 1909, and are all the unpaid and unredeemed taxes upon and against said real property. You and each of you, (including said persons unknown, if any), are hereby further notified and summoned to be and appear within sixty days after the date of publication, and the exclusive of the day of said first publication, to-wit: 60 days after the 23rd day of July, 1909, in the above entitled-court and action; and defend this action and answer the complaint of said plaintiff and answer the complaint of said plaintiff underwritten attorney for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against each parcel of property due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and found against it respectively as proffered law, and as prayed in the complaint, now on file in this cause and court. Attorney for Plaintiff. Office Address: 314 Northern Bank & Trust Co. Bldg., Seattle, Wn. July 23—Sept. 3, 1909. PROBATE NOTICE. IN THE SUPERIOR COURT OF THE State of Washington, for the County of King. State of Washington. County of King—ss. In the Matter of the Estate of Margaret A. Dalrymple, deceased. No. 4509. No- o. 4510. Notice is hereby given that Lillie E. Dalrymple, administratrix with the will annexed of the estate of Margaret A. Dalrymple, deceased, has rendered to, and filed in said court her final account as such administratrix, and that Thursday, the 16th of October, 2014, at clock p. m., at the court room of the Probate Department of our said Superior Court, in the City of Seattle, in said King County, has been duly appointed by said court for the settlement of said estate. The person interested in said estate may appear and file his exceptions in writing to said account, and contest the same. Witness, the Hon. Mitchell Gilliam, Judge of said Superior Court, and the seal of said court hereto affixed this 15th day of July, 1909. D. K. SICKELS, Clerk. By PERCY F. THOMAS, (Seal) Deputy Clerk. J. M. WIESTLING. Attorney for Estate. July 16-August 9, 1909. IN THE SUPERIOR COURT OF THE State of Oklahoma for the County of King. In Probate. In the Matter of the Estate of Margaret A. Dalrymple, deceased. No. 4509. Order to Show Cause. Why Distribution Should be Made. Lillie E. Dalrymple, administratrix with the will annexed, of the estate of Margaret A. Dalrymple, deceased, having filed in this court her petition setting that the residence of the person to be closed and is ready for distribution of the residue thereof among the persons entitled by law thereto, and it appearing to the court that said petition sets worth facts sufficient to authorize distribution of the residue of said estate: It is therefore ordered by the court that all persons interested in the estate of the deceased be and appear before the said Superior Court of King County, State of Washington, at the court room of the Probate Department of said court in the county of King County. gust, 1909, at the hour of 2 o'clock p. m. of said day, then and there to show cause, if any they have, why an order of distribution should not be made the residence of the person among the hired person in said petition mentioned, according to law. It is further ordered, that a 'copy of this order be published once a week for four successive weeks before the day of July, 1909, in The Seattle Republican, a newspaper printed and published in said King County and of general circulation therein. Done in open court this 15th day of July, 1909. MITCHELL GILLIAM, Judge. State of Washington. County of King—ss. I. D. K. Sickels, County Clerk of King County and ex officio Clerk of the State of Washington. State of Washington, for the County of King, do hereby certify that the foregoing is a full, true and correct copy of an original order to show cause, made by said court on the 15th day of July, 1909, in the matter of state of Margaret A. Dalrymple, deceased. Witness my hand and the seal of said court this 15th day of July, 1909. D. K. Sickels, Clerk. BY PERCY F. THOMAS. (Seal) Deny Clerk. IN THE SUPERIOR COURT OF THE State of Washington for the County of King. State of Washington, County of King. -ss. In the Matter of the Estate of Julia Mehlhorn, Deceased. No. 8865. Notice of Settlement of Final Account. Notice is hereby given by August Mehlhorn, the County of Seattle, Julia Mehlhorn, deceased, has rendered to, and filed in said court his final account as such executor, and that Thursday, the 9th day of September, 1909, at 9:30 o'clock, a. m., at the Court Room of the Probate Department of our said Superior Court, in the County of Seattle. King County has been duly appointed by said court for the settlement of said account, at which time and place any person interested in said estate may appear and file his exceptions in writing to said account, and contest the same. Witness, the Hon. Boyd J. Tallman, Judge of said Superior Court, and the seal of said court hereto affixed this 5th day of September, 1909. August 6—Sept. 3, 1909. IN PROBATE. IN THE SUPERIOR COURT OF THE State of Washington for the County of King. In the Matter of the Estate of Julia Mehlhorn, Deceased. No. 8865. Order to Show Cause Why Distribution Should Not be Made. August Mehlhorn, executor of the estate of Julia Mehlhorn, deceased, having filed in this court his petition setting forth that said estate is now in a condition to be closed. In a condition to be closed, the residue thereof among the persons entitled by law thereto, and it appearing to the court that said petition sets forth facts sufficient to authorize a distribution of the residue of It is therefore ordered by the court that all persons interested in the estate of the said Julia Mehlhorn, deceased, and be appear before the said Superior Court of King County, State of Washington, at the court room of the Prince Department, in the City of Seattle on the 9th day of September, 1909, at the hour of 2:30 o'clock, P. M., of said day, then and there to show cause, if any they have, why an order of distribution should not be made of the residue of said estate among the heirs and persons in said petition mentioned, accustomed to the order, is further ordered, that a copy of this order be published once a week for four successive weeks before the said 9th day of September, 1909, in the Seattle Republican, a newspaper printed and published in said King County and of general circulation here. Done in open court on the 5th day of August, 1909, BOYD J. TALLMAN, August 6-Sept. 3, 1909. Judge. IN THE SUPERIOR COURT OF THE State of Washington, in and for the County of King. Mimie Gilsey, Plaintiff, vs. James Gilsey, Disposition. No. 68802. Summons by Publication. The State of Washington to James Gilsey, Defendant: You are hereby summoned to appear with sixty days after the date of the plaintiff, with sixty days after the wit, within sixty days after the 6th day of August, 1909, and defend the above entitled action in the court aforesaid, and answer the complaint of the plaintiff and serve a copy of your answer or other pleading, to the undersigned at toney to the plaintiff at his office address stated below; and in case of your failure so to do, judgment will be rendered against you according to the demand of the plaintiff's complaint which has been filed with the clerk of the above court. The object of this action is to procure an absolute dissolution of the bonds of matrimony now existing between the parties to this action on the grounds of abandonment for more than one year past, and upon the ground of non-sup- Attorney for Plaintiff. Office and P. O. Address: 403 New York Block, Seattle, Washington. August 6-Sept. 17, 1909. TO THE STOCKHOLDERS OF THE UNION COAL & DELIVERY CO. You are hereby notified that there will be held at Room 230 Arcade Annex, August 7th, 1909, at 7:30 p. m., the annual meeting of the stockholders of the Union Coal & Delivery Co. Trustees for the following year will be elected and other business which may come before said meeting will be held. IN PROBATE. IN THE SUPERIOR COURT OF THE State of Washington for King County. In the Matter of the Estate of Stuart M. Gage, Deceased. No. 10347. Notice to creditors. Notice is hereby given to the creditors, and all persons having claims against the sald deceased or his estate, to present the same, with the necessary document, to the office of A. H. Mackinnon, at the office of A. H. Mackinnon, 310 Epler Block, in the City of Seattle, King County, Washington, the same being the place of transaction of business of said estate, one year from the date of said first publication of this notice, to-wit: within one year from the 5th day of August, 1909. STELLA M. GAGE, Administratrix. A. H. MACKINNON, Attorney for said Estate. Dated Seattle, Washington, July 31, 1909. August 6—Sept. 3, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. In the Matter of the Estate of Eliza- beth Goreau deceased. No. 10233. Notice to Creditors. By order of court said court made herein on the 1st day of July, 1909, notice is here- by given to the creditors of, and to all deceased or against, said estate of said deceased or present them with the neces- sary vouchers to the undersigned admini- strator of said estate, at Room 28 Downs Block, in Seattle, the business of state, in Seattle, the said county and state, within one year from and after the date of first publication of this notice or same will be barred. Date of first publication, August 6, 1909. FRANK WOOD. As Administrator of said Estate, W. W. FELGER. PROBATE NOTICE. IN THE SUPERIOR COURT OF THE State of Washington for the County State of Washington, County of King, —ss. In the Matter of the Estate of John McGee, Deceased. No. 8094. Notice of Settlement of Final Account. Notice is hereby given that Christina McGee, the administratrix of the estate of John McGee, deceased, has rendered to, and filed in said court her final account as such administratrix, and that Thursday, the 9th day of September, 1909, at 2:30 o'clock p. m., at the Court Room of the Probate Court in the City of Seattle, in said King County, has been duly appointed by said court for the settlement of said account, at which time and place any person interested in said estate may appear and file his exceptions in writing to said account, and contest the time. Witness, the Hon. Boyd J. Tallman, Judge of said Superior Court, and the seal of said Court hereto affixed this 3rd day of August, 1909. D. K. SICKLES (Seal.) By C. C. BURTIS Deputy Clerk. August 6—Sept. 3, 1909. IN THE SUPERIOR COURT OF THE State of Washington for the County of Kahns. In Probe. In the Matter of the Estate of John McGee. Deceased. No. $094. Order to Show Cause Why Distribution Should be Made. Christina McGee, administratrix of the estate of John McGee, deceased, having filed in this court her petition setting forth that said estate is now in a condition to be sold to the person contributing of the residue thereof among the persons entitled by law thereto, and it appearing to the court that said petition sets forth facts sufficient to authorize a distribution of the residue of said estate. Therefore ordered by the court that all persons interested in the estate of the said John McGee, deceased, be and appear before the said Superior Court of King County, State of Washington, at the court room of the Probate Court at the Seattle office of the County of Seattle on the 9th day of September, 1909, at the hour of 2:30 o'clock p. m., of said day, then and there to show cause, if any they have, why an order of distribution should not be made of the residue on said estate among the persons assigned in said petition mentioned, according to law. It is further ordered, that a copy of this order be published once a week for four successive weeks before said 9th day of September, 1909, in a newly newspaper printed and published in said King County and of general circulation therein. Done in open court this 3rd day of August, 1909. SEATTLE REPUBLICAN M. R. Cayton ..... Editor and Publisher Susie Revels Cayton ..... Associate SUBSCRIPTION RATES. One Year ..... $8.00 Six Months ..... 1.50 Three Months ..... 75 Entered at the Postoffice at Seattle as Second Class Mail Matter. Legal Publications a Specialty. Governor Johnson ran into a Chilberg at the exposition and that, too, in mid-summer. Hay is so common to the state of Washington that the Eastern visitors say it is to even be found in large quantities in the executive mansion. Will Rip linger longer in Seattle than he anticipated when he returned to confront his accusers? James A. Moore has been offered a round million dollars for his interest in the Irondale plant, and yet there are those in Seattle who declare that James needs more money to pull through on. Intoxicants may be had on the Pay Streak, so declares the Rev. Reese. If drink is sold on the exposition grounds that's a pay streak worth its weight in gold. Despite the fact that there have been a half dozen or more state governors in Seattle for the past week the citizens have managed to live through it. Everett was in Seattle last Tuesday with both feet, her hundred thousand dollar fire the evening previous to the contrary notwithstanding. Everett is a burg that it will pay to hook up with. We suspect the reason Thomas Levi's aeroplane did not fly last Sunday was because he had not gotten any government hot air to warm things up with. That young millionaire that was put on cold storage a few months ago for the killing of Stanford White has not quite Thaw(ed) out, but the weather seems to be warming up. Despite the fact that George Gau, a well-known Seattleite, has always been of a sober turn, yet he had a bad case of snakes last Tuesday, which greatly surprised his hundred and one friends. He was appointed receiver for a snake show. The largest pipe organ in the world, erected in Festival Hall, on Art Hill, at the Louisiana Purchase Exposition, in 1904, by a Los Angeles (Cal.) firm, at a cost of $110,000, has been purchased by Mr. John Wanamaker, who will have it erected in his big department store in Philadelphia. Although the organ is so immense a pony may be driven through its largest pipes and it will require ten large freight cars to remove it to Philadelphia, it is pronounced a most perfect instrument. --- PROMINENT PERSONS. PROMINENT PERSONS. William Jennings Bryan, three times Democratic candidate for the presidency of the United States, and as many times most signally defeated, is to leave the state of Nebraska and take up his residence in Texas. If the man ever before had any chance of being elected president he is destroying every future hope by becoming a Southerner. --- Mrs. Alice Roosevelt Longworth has become an enthusiastic advocate of the success of the aeroplane and is anxious to take a trip in one of them. She, however, has decided to take a spin through the air in a balloon. Alice always was a dare devil and she seems to have lost none of it by permitting Nick Longworth to become her husband.. A. D. Charlton says the travel to the A.-Y.-P. exposition has been twice what it was to the Lewis and Clark exposition at Portland for the same length of time. Of course it has been, and simply because the former is being held in Seattle and the latter was held in Portland. It makes all the difference in the world, neighbor, where you hold a show. --- Mme. Lillian Nordica, America's most noted actress, has recently become the wife of George W. Young, a New York banker and a man reputed to be of vast wealth. They are now off for a month's honeymoon on Mr. Young's private yacht. Lillian having taken so many of just such trips, she must be an adept at the business by this time and it is safe to say she will give George the ride of his life. Edward C. Hanford of Seattle, a son of Judge C. H. Hanford, has been appointed a second lieutenant in the regular army and the appointment has been confirmed. The Hanfords and the Hopkins of this section of the country always manage to feed at the public crib. --- Tafts tariff took a sudden turn and was passed by Congress after a good many heated debates. It is a compromise between the extreme Aldrich men and the radical reduction men. It nevertheless is for the most part in the interest of the corporations and combines common to the country just now. Orville Wright, of aeroplane fame, is determined to make the flying machine an absolute success and have it skim the air with as much ease and grace as does the automobile the plains. We believe Wright is right. --- James J. Hill's bronze bust presented to the University of Washington by the state of Minnesota was unveiled last Tuesday, Minnesota day, at the exposition, and was formally presented to the university by Governor Johnson of that state. Mr. Hill can rightfully be classed as the father of the Northwest. Col. Clinton P. Ferry, the man who gave Tacoma its name, died in California last Sunday after a very brief illness. He was one of the public spirited men in the City of Destiny and many of its public enterprises bear his name THE SATTLE REPUB N in honor of the noble work he has done for the good of the city from time to time. Mrs. Charles Prosch, an octogenarian of Seattle, died at her home last Sunday afternoon. She was a pioneer to this section, having resided in the state and territory for the past fifty-one years. Both she and her husband, who survives her, have been among the prominent citizens of this section and city during their residence here and have always been closely identified with all enterprises which had for its object the developing of the country. She was one of the most influential members of the Pioneer Society, many of the members of which attended the last sad rites paid to her memory. FRANK CLAPP'S RECORD. Here is a pretty good story on former Senator Frank Clapp. A few days ago as he was going up Second avenue he met Fred C. Harper, with whom he has been not only acquainted for many years, but with whom he enjoys a close friendship. Hellow, Frank, I am glad to see you, came from Harper. And the same to you, was Clapp's rejoinder. The two shook hands and were delighted to see each other. Finally Clapp, after looking at Harper and seeing that he was togged up unusually good, said, "If it were dark I would hold you up." "Well you have improved wonderfully since I first knew you," replied Harper, "for when I first knew you you would not wait for it to get dark to hold me up, but would do the job in broad daylight." Before the coloquoy, however, reached the last retort of Harper a crowd ahd assembled and Clapp seemed to enjoy the real joke as much as a mutual friend of the pair. Ours is said to be a government of laws and not of men. But men pass the laws and often one man causes a law to pass, or gives it character or keeps them from passing. We, with all our trying and studying, have not been able to free ourselves from the one-man power which the ancient republics dreaded and detested. At this time we do not regret it. A strong demand for tariff revision, and both great parties came out for it, put it in their platforms, nominated candidates and went before the people. Congress was called in special session to attend to the matter. The matter has gone to eleven men over against them is set the ne man, the President, who stands for, so far as we can judge, for that which was demanded and promised. President Taft, it seems, is for the principal of protection and necessarily against the Aldrich bill. He said that he was committed to a downward revision of the tariff which he had promised, and he had looked at the matter from the standpoint of the whole country as well as the standpoint of responsibility for the whole Republican party. He said the question in each case was a question of fact, to be determined by evidence as to whether the present duty was needed for protection or if the rate was excessive, so that downward revision or putting the article on the free list would not injure the industry. WISE AND OTHERWISE (UNCLE ANCIL) The city authorities should require all vacant lots to be cleared of all trash and debris and treated as a first class park. How much better the city would look to have this done, and too, it would be an aid to health. Why not require the owners of the vavant lots to do this, and upon their failure let the city keep them in good shape and charge the cost against the property. The owners of vacant lots profit by the increase value given to the property by the improvements made in the vicinity, and yet they add nothing to the beauty of the city, and often these lots are an eye-sore to the community. Let the city compel the owners to keep these lots in good order. Marriage between people of different colors and nationality should not be prevented. If a man and woman are attached to each other as husband and wife should be, the matter of color should not be a bar to their union. If a woman of color should marry a scapegoat of a white man and get fooled, she alone must bear the burden. Besides, it can be shown that an intermixture of races is elevating. Progeny is made better by a cross between different nations. This is the case among the inferior animals. This fact cannot be refuted. If a white girl wishes to marry a Jap, let her marry him. The Almighty has placed no bar between people of different nationalities marrying; then why should we? The Indian is fast passing away. In the United States the time was when there were more Indians than white people, and but a few fleeting years ago the Indians were more numerous in the territory, now state of Washington, than the whites. But they are fast passing to the "happy hunting grounds." Twenty years ago the red men were numerous in and around the city of Seattle, but now but few are left to tell the tale of the once numerous Siwash. Mika memoloos pe mitlite kopa Sahalee Tyee. If this is the ease with the Indian as well as with other races of people, can it not be that in the course of thousands of years the races now existing will become extinct and be replaced with a superior race of people? As this is a world of progress and evolution, and its tendency is that way, certain it is that the people of the world are tending upward in the loftier elements of thought and sentiment and are obeying te mandates of Nature's God. This is an era of graft. Grafting is performed in various and sundry ways. For instance, a contract may be let for an exorbitant sum in which there is a rake-off of many dollars between the legitimate value of the work and the sum for which it was let. The difference is the graft, which is a theft to be divided between the thieves, who have really stole that amount of money. The man who demands and receives more salary than he is entitled to by conniving with some grafter, is no less a grafter and should be placed in the list of theives. The word grafter means the same as the word thief, only its a milder term. The man in any kind of public or private position who de- FRIDAY. AUGUST 6. 1909 mands more of a salary than is a just compensation because he thinks they can't do without him, is a grafter at heart. There are just as good fish in the water as were ever taken out. By all means Seattle should have a well qualified man as superintendent of its schools, but it can obtain the services of a man amply qualified for five or six thousand dollars per year. Five hundred dollars per month is even excessive wages. Seattle should not try as yet to compete with Chicago and New York. She is only in her short clothes. Ten thousand dollars paid out by the school board every twelve month should not be given away simply because some professor wants it. Your Uncle has known cases of this kind to be a simple bluff. That a new county court house and a city hall are really needed in the city of Seattle cannot be disputed. The present court house has been added to as much as it can be, and is now entirely inadequate for the transaction of the courts' business. By commencing the building of a new court house next year it might be occupied before it would be absolutely necessary to rent additional quarters at the present location. The building should be large enough to serve all purposes in the remote future. It would not remedy matters to erect a building for the present only; neither would it be wise to erect one for the immediate future. The city is homeless—the ramshackle structure which the officers have occupied has recently been demolished and they are occupying a building not designed for a city hall. That part of Jefferson street between Third and Fourth avenues should be vacated and a "way" made from the court house to the city hall. A jail should be erected by the side of the court house, not under it. The superior judges should be appointed by the county commissioners to select a building committee to take charge of both the erection of the building and the finances. Antigrafters should be chosen. If this country is to return to real prosperity there must be concerted action on the part of both rich and poor to do away with extravagance. Reckless expenditures in excess of one's earnings are among the evils of the day. The poorer class almost invariably seek to imitate the rich in high living, in wearing costly garments and in doing other foolish things. All should live within their means and live the simple life. Envy brings unhappiness and makes people miserable. The Irishman sees the rich that ride in their chaises, while the poor have to walk be J—es and the human heart is dissatisfied and he strains every nerve to emulate the fellow in the automobile. The man has a happy faculty who can adapt himself to his environments and be satisfied with his condition. It is the everlasting race to keep pace with the rich that keeps the poor in poverty and indulges the rich in luxury. Envy, in order to be in fashion, will spend the dollar that should be made to earn another. If the poor would practicie the simple life prosperity would be attained. There appears to be a question as to whether intoxicating liquors should be dispensed in clubs with- MEN WHO ARE BUILDING SEATTLE In this issue two other men, presented to the readers. NO man tle, has done more for her upbuild trait accompanies these words. N he was for many years an enthusi town, but Seattle has always occu and one favors he went out of and Seattleites thoroughly demon a Seattle idol, got some of its be erton navy yard is a stern reality, postoffice got its most substantial haps, would never have had a g to the wheel. Seattle might not son made a personal plea for it. highly, in its infancy was nourish meration go on ad infinitum, but demonstrate that when in Congre he got have been more instrument her other enterprises. After hav son cast his lot in Seattle and beeper of the Northwest, the Seattle has been as much or more instru r largest and most extensive indust ries Seattle’s fame to the utmost United States have begun to set u reason than because she has a Job who in and out of season insists will go down in the history of Sea benefactors, and all because he most. M. JOHN LOCKWOOD WILSON. other men, who can be properly stu- ter. NO man now living in Seattle, later upbuilding than the Hon. John Lewords. No, he has not always liven- an enthusiastic Spokane man and always occupied a warm spot in his hit out of his way, while in Com- pany demonstrates that fact. The of its best boosts from John L. Lewords reality, is due almost wholly substantial appropriation through which had a government assay office he right not have had a sub-port of en- sa for it. The army post, which he has nourished by Senator Wilson. Bitum, but, what's the use, for ove- n Congress he always got things in instrumental in Seattle becoming After having been retired from ove- r and became the proprietor of the the Seattle Post-Intelligencer, and are instrumental in the upbuilding of industrial concern within he are utmost ends of the world and can to set up and take notice of S- has a John L. Wilson, who has a b in insists on Seattle getting a squ ory of Seattle marked with as m because he did things for Seattle. In this issue two other men, who can be properly styled Seattle Builders, are presented to the readers. NO man now living in Seattle, or who has lived in Seattle, has done more for her upbuilding than the Hon. John L. Wilson, whose portrait accompanies these words. No, he has not always lived in Seattle; yea, verily, he was for many years an enthusiastic Spokane man and even yet loves the old town, but Seattle has always occupied a warm spot in his heart, and the thousand and one favors he went out of his way, while in Congress, to do for Seattle and Seattleites thoroughly demonstrates that fact. The Lake Washington canal, a Seattle idol, got some of its best boosts from John L. Wilson. That the Bremerton navy yard is a stern reality, is due almost wholly to his efforts. Seattle's postoffice got its most substantial appropriation through his efforts. Seattle, perhaps, would never have had a government assay office had he not put his shoulder to the wheel. Seattle might not have had a sub-port of entry had not John L. Wilson made a personal plea for it. The army post, which all Seattle appreciates so highly, in its infancy was nourished by Senator Wilson. And thus might this enumeration go on ad infinitum, but, what's the use, for enough has been said to demonstrate that when in Congress he always got things for Seattle and the things he got have been more instrumental in Seattle becoming a great city than any of her other enterprises. After having been retired from official life, Senator Wilson cast his lot in Seattle and became the proprietor of the leading Republican paper of the Northwest, the Seattle Post-Intelligencer, and through its columns he has been as much or more instrumental in the upbuilding of Seattle than even the largest and most extensive industrial concern within her gates. His paper carries Seattle's fame to the utmost ends of the world and the leading men of the United States have begun to set up and take notice of Seattle and for no other reason than because she has a John L. Wilson, who has a Seattle Post-Intelligencer, who in and out of season insists on Seattle getting a square deal. John L. Wilson will go down in the history of Seattle marked with as much glory as any of its benefactors, and all because he did things for Seattle when she needed them most. out a license. Just why a club is allowed to deal out liquors without a license, while other saloons have to pay a heavy license, is not very clear. And just why the authorities let them run without licenses is a query. Of course the aristocratic silk stocking gentry don't like the name of saloon attached to their club, but it is a saloon just the same, and there should be no discrimination between saloons. The fact is that --- ```markdown ``` FRIDAY. AUGUST 6, 1909 who can be properly styled Seattle, or now living in Seattle, or who has held than the Hon. John L. Wilson. So, he has not always lived in Seattle, asiatic Spokane man and even yet, occupied a warm spot in his heart, and his way, while in Congress, to illustrate that fact. The Lake Wash. post boosts from John L. Wilson. The city, is due almost wholly to his effort in appropriation through his efforts, government assay office had he not put have had a sub-port of entry had not. The army post, which all Seattle is led by Senator Wilson. And thus now, what's the use, for enough has he always got things for Seattle, in Seattle becoming a great city being been retired from official life, name the proprietor of the leading Post-Intelligencer, and through mental in the upbuilding of Seattle, serial concern within her gates. It ends of the world and the leading up and take notice of Seattle and John L. Wilson, who has a Seattle Post on Seattle getting a square deal. Jettle marked with as much glory did things for Seattle when she the club saloon is the most dangerous of all because of its hidden identity. On the surface there is a respectability, while a vile serpent lurks within. The old soldiers, the veterans of the Civil war, who saved this country from destruction, should receive all the attention this country and state can give them. Whatever they wish, let them have. Nothing too much can be done for them. They are old and --- THE SEATTLE REPURLICAN Builders, are lived in Seattle, whose porch; yea, verily, loves the old canal of the thousand loft for Seattle Washington canal, what the Bremarts. Seattle’s Seattle, perch his shoulder at John L. Wil- appreciates so might this enu- been said to and the things by than any of Senator Wil- Republican parts columns he than even the paper car- men of the for no other Intelligencer, John L. Wilson as any of its needed them In presenting of the builders o-ator Wilson, he he has not lived greatness had be- he did throw his most powerful f- a natural born he is able to rem- has built up a g- so without at the feed. This is an getic newspaper, the aid and assist afternoon p- Times the most f- fame and fortune man with the m- one o fthe most o public enterprise takin gthe lead in ting the results, dents thereof are famous Seattle S- terprising editor- not because he w- because he was great financier, m- he built up a great Seattle. grizzly and in a few more fleet years they will be with us no more. Justice, as well as sympathy, demands that they be treated the best. The veterans who are at Orting want to be transferred to the new Bremerton home, and there is some delay or hitch about it which should not be. The so-called home at Orting is the most godforsaken place in the state, located in a hole, with no view and with no at- --- ALDEN J. BLETHEN. estating the name of Col. Alden J. Blethens, of Greater Seattle, we verily believe that he has not always liven in Seattle, yea, that lived in Seattle to exceed a decade, and that he well been well laid before he cast his lot on himself into the rising current, that crucial force had come to its assistance. Col.own newspaper man, and that of itself play a grender any city, in which he casts his life a great paper for the Blethens, but it was the same time building a great city on an age of newspaperdom and the newspaper is like unto an ambitious politician, assistance of the newspapers—a miserable paper, with a few thousand subscribers, most widely read paper in the Northwest. Fortune has become the property of the wife, the money to her, who has invested the sack of most enterprising cities in the world. In arise, it is not a matter of like or dislike and in its building, but it is whether or not, and the man who is getting the rest are under lasting obligations to. Renew the Spirit, many years from now will find Victor and publisher of the Seattle Daily of the was a great engineer, not because he was a great statesman in the halls of Coler, nor not because he was a great captain, great newspaper and used its columns for traction. It is a crime to keep the home there when there is a better place at Bremerton. It was during a trial in an Alabama city more than twenty years ago that one of the jurors suddenly rose from his seat and precipitately fled from the courtroom. He was arrested in his flight before he had left the building and brought back. "What do you mean by running argu off in that way?' asked the judge, who knew the man to be a simple, honest farmer. "It's like this, your honor," said the man, earnestly. "When Mr. Hobbs finished talking my mind was all clear, but when Mr. Clayton began I was all confused again, and I said to myself, 'I'd better leave at once, and stay away till he's done,' for to tell the truth, I didn't like the way the argument was going, your honor." --- Notice of Sheriff's Sale of Real Estate STATE OF WASHINGTON, COUNTY OF King-ss. Sheriff's Office. By virtue of an order of sale, issued out of the Honorable Superior Court of King County, on the 6th day of July 1909, by the Clerk thereof, in the case of W. H. White and Kittie, B. White, his wife, plaintiffs versus Minnie J. Perry and Herbert V. Perry, et vir; and Anna A. Empzminger and George Empzminger, et vir, defendants, No. 64074, and the as Sheriff, directed and delivered: Notice is hereby given, That I will proceed to sell at public auction to the highest bidder for cash, within the hours prescribed by law for Sheriff's sales, to wit: at 10 o'clock A. M. on the 21st day of August, A. D. 1909, before the Courts House door of said King County, in the State of Washington, all of the right, title and interest of the said defendants in and to the following described property, situated in King County, State of Whittier, J. W. The North half of the Southeast quarter of the Southwest quarter of the Northeast quarter of Section Nineteen, Township Twenty-two township, Range W. With Meridian; saw except a strip fifteen feet wide along the west side of said tract, which is hereby dedicated as a public road. Said tract contains five acres, more or less, and is numbered thirty-four according to app. F. H. W. with March 8th, 1992, leveled on as the property of said defendants to satisfy a judgment of a foreclosure of a mortgage amounting to two hundred thirty-nine & 43/100 ($239.43) dollars, and cost of suit, in favor of plaintiff. Dated this 7th day of July, 1999. ROBERT T. HODGE, Sheriff. By BERT C. THOMPSON, Deputy. IN THE SUPERIOR COURT OF THE State of Washington in and for the County of King. Clifford H. Birkel, Plaintiff, vs. Addie Birkel, Defendant. No. 68.025. Summons and Service of publication. By Washington to the said Addie Birkel, Defendant: You are hereby summoned to appear within sixty (60) days after the date of the first publication of this summons, to-wit, within sixty (60) days after the date of your last judgment, and above entitled action in the above entitled court and answer the complaint of plaintiff and serve a copy of your answer upon the undersigned attorney for plaintiff at his office below stated and in case of your failure so to do, judgment will be rendered against you according to the demand made in court and with no clerk of said court. The object for which this action is brought is to obtain a decree of divorce from the defendant on the following grounds: First. Because the defendant for the past eight or nine months without plaintiff's life burdensome and to make it impossible for him to live with her in peace and happiness. Said personal indignities consisting of acts of cruelty by the defendant to the plaintiff also acts of immorality, lewd conduct and evagance upon the part of the defendant. P. O. Address: 429-30 Epler Block, 813 Second Avenue, Seattle, Washington. July 9—August 20, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Mildred N. Matteson, Plaintiff, vs. H. H. Matteson, Defendant. No. —, Summaries —. The State of Washington, to the said H. H. Matteson, Defendant: You are hereby summed to appear within sixty days after the date of the first publication of this summons, to wit: In July 1909, the State of Washington of July 1909, and defend the above entitled action in the above entitled court, and answer the complaint of the plaintiff, and serve a copy of your answer upon the undersigned attorney for plaintiff, at his office below stated; and in case, that the complaint will be rendered against, you according to the demand of the complaint, which has been filed with the clerk of said court. The object of the above entitled action is to obtain a decree of divorce from the defendant upon the grounds of the indemnity and non-support and inhuman treatment and non-support for more than one year last past. GEORGE FRIEND. Post Office Address: 916 Alaska Building, Seattle, King County, Washington. July 9—August 20, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. In the case of disincorporation of the Washington Bonding & Surety Company. No. 68,049. Notice of Disincorporation. Notice is hereby given by the undersigned, the Senior Court of the State of Washington, for King County, that the Washington Bonding & Surety Company, a corporation, organized and existing under and by virtue of the laws of the State of Washington, held in this petition to be dissolved and disincorporated, setting forth that at a meeting of the stockholders, held for that purpose it was unanimously decided to disincorporate said corporation, and that the 7th day of September, 1909, has set the 7th day of September, 1909, at 9:30 A. M. in the said department, as time when the said petition will be heard in his said court room in the Court of the said King County at Seattle, Washington. Therefore notice is hereby given that at said time and place the petition of said Washington Bonding & Surety Company to dissolve and disincorporate will be heard and all persons interested in the matter would be heard upon the matters and things pertaining to said petition. Witness my hand and the seal of this court this 7th day of July, 1909. (Seal) D. K. SICKELS, County Clerk and Ex-officio Clerk of the Superior Court of King County By W. K. SICKELS, Deputy. july 9—August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. In the Matter of the Estate of Wm. W. Cosper, Deceased. No. ____. Notice to Creditors. On the occasion of said court made herein on the 29th day of June, 1909, notice is hereby given to the creditors of, and to all persons having claims against said deceased or against said estate, to pres- tent them with the necessary vouchers to the undersigned administrator of said estate, at 911 Lowman Building, Seattle, Washington, the place of residence of said estate, in Seattle, in said county and state, within one year from and after the date of first publication of this notice or same will be barred. Date of first publication, July 9, 1909. FRANK E. COSPER. As Administrator of said Estate. GRAVES ADMINISTRATOR. Attorneys for Estate. 911 Lowman Bldg., Seattle, Wash. July 9—August 6, 1909. NOTICE AND SUMMONS. State of Washington, for King County, Aurora Land Company, a Corporation, Plaintiff, vs. W. G. Rose and Jane Doe Rose, his wife, whose true Christian name is unknown, and all persons unk- nown, if any, having no right to in- tain and to the hereinafter descri- bed real property, Defendants.—No. 66212. State of Washington to the above defen- dants and each of them: You and each of you, as owners, claim- ing or holding the best or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the holder of one certain delinquent tax certificate issued by the treasurer of King County, State of Washington, for King County, 1908, and numbered as follows, for the delinquent taxes of the following year, in the following amount, and upon the real property situated in said King County, described as follows, to-wit: King County Syndicate's Second Addition to Kirkland—Lot 12, block 10, certificate number B 49506, year 1904, amount 84 cents. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described Lot 12, block 10, Kirkland Syndicate's Second Addition to Kirkland—37 cents for year 1905, 49 cents for year 1906, 50 cents for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from said date of payment, and are all the sums incurred taxes upon and against said real property. You and each of you (including said persons unknown, if any), are hereby further notified and summoned to be and appear within sixty days after the date of publication, and are exclusive of the day of said first publication, to-wit, 60 days after, July 2, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and give evidence of the award of the dersigned attorney for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herewith, and costs against each parcel of said real property for the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property and for the satisfaction of it, respectively as provided by law, and as prayed in plaintiff's complaint, now on file in this cause and court. AURORA LAND COMPANY, a Corporation Plaintiff. F. J. CARVER Attorney for Plaintiff. Office Address: Northern Bank & Office Nashville, Wash. July, 2, August 13, 1999 NOTICE OF SALE OF REAL ESTATE AT PRIVATE SALE BY GUARDIAN. IN THE SUPERIOR COURT OF THE State of Washington, for King County, In the Matter of the Estate of Mark Robert Morris, a juror - No. 10269. Notice is hereby given that on the day of the first publication of this notice, toowit, on Friday, the 30th day of July, A. D. 1909, and thereafter within ninety days from and after the 22nd day of July, will receive bids for the sale of the real estate hereafter described, the property of said minor, and said real estate will be sold at such time as the underwriter deem advisable on and after the 14th day of August, A. D. 1909, and within ninety days from and after the 22nd day of July, 1909. All bids on said real estate must be in writing and each bid identified check payable to the order of W. H. Vincent in an amount equal to ten per cent of the amount bid and must be presented to the undersigned guardian personally or left at the office of Brady Rummons attorneys for said guardian. Rummons attorney are hereby referred are described as follows, toowit: An undivided one-twenty-fourth interest, of, and to the north half (N. ½) of the northeast quarter (N. E. ½) of the northeast quarter (N. E. ½) of the northeast quarter (N. W. ½) of the northeast quarter (N. W. ½) of section eighteen (18), township twenty-two (22), north range five (5) east, Willamette Meridian, in King County, the State of Washington, being all the right, title and interest in the land, sea and land of the lands and premises above described. Dated this the 26th day of July, A. D. 1909. W. H. VINCENT. Guardian of Mark Robert Morris, a minor. SUMMONS FOR PUBLICATION. IN THE SUPERIOR COURT OF THE State of Washington, for King County. H. McCormick Improvement Company, a corporation and safteft vs. western Electric Company, a corporation, Dedendant—No. 68365. The State of Washington to Western Electric Company, a corporation, organi- ficated by the State of New York dedendant: You are hereby summoned to appear within sixty (60) days after the date of the first publication of this summons, upon which sixty (60) days after the 30th day of January 2014, above entitled action in the above entitled court, and answer the complaint of the plaintiff, and serve a copy of your answer upon the undersigned attesting that you have been of your choice stated; and in case of your failure so to do, judgment will be rendered against you according to the demand of the complaint which has been filed with the Clerk of said court. The object of this complaint is to demand that materials furnished by plaintiff to defendant, and to secure and enforce, by garnishment, attachment and execution, any judgment received against any money, credits stock or other property owned by you, in the session or under the control of the Western Electric Company, a corporation organized under the laws of the State of Washington, and against any interest in the capital shock of the last named corporation and owned by said defendant. GEO, DYSART and MILO A. ROOT Post and Office Address: 631-2 New York Block, Seattle, King County, Washington. July 30 - Aug 10 Have a Legal? Phone Main 305 The Seattle Republican THE SEATTLE REPUBLICAN State of Washington, for King County, Aurora Land Company, a corporation, Plaintiff, vs. Chas. H. Baker and Jane Doe Baker, his wife, whose true Christian name is unknown, and all persons unknown, if any, having or claiming an entitlement to the land or the property described real property, Defendants.—No. 66211. State of Washington to the above defendants and each of them: You and each of you, as owners, claimant and the owner in the best or estate in and to the hereditatter described real property, are hereby notified that the above named plaintiff is the holder of one certain delinquent tax certificate issued by the treasurer of King County, and the holder of the 24th day of April, 1908, and numbered as follows, for the delinquent taxes of the following year, in the following amount, and upon the real property situated in said King County, described as follows, Kirkland Syndicate's Second Addition to Kirkland—Lot 10, block 10, certificate number B 49502, year 1904, amount 84 cents. That the taxes for the following prior and subsequent years have been paid by the subscriber upon said above described real property, to-wit; Lot 10, block 10, Kirkland Syndicate's 2nd Addition to Kirkland—37 cents for year 1905, 49 cents for year 1906, 50 cents for year 1907, 35 cents for year 1908. Which several sums bear interest at the rate of 15 per cent, per annum from said date of payment, and are all the unpaid and overdue fees upon and upon said real property. You and each of you (including said persons unknown, if any), are hereby further notified and summoned to be and appear within sixty days after the notice of publication of this notice exclusive of the day of said first publication, to-wit, 60 days after July 2, 1909, in the above entitled court and action, and defend this action and answer the complaint of said plaintiff and serve a copy of the notice for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fall so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against the sums of the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and found against it if requested, and is prayed in plaintiff's complaint, now on file in this cause and court. AURORA LAND COMPANY, a Corporation, F. J. CARVER, Attorney for Plaintiff. Office Address: Northern Bank & Trust Co. Bldg., Seattle, Wash. July 2—August 13, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County, Lewis Wohlman, Plaintiff, vs. Lea Wohlman, Defendant. No. 67743. Summons by Publication. The State of Washington to Lea Wohlman, Defendant: You are hereby summoned to appear within sixty days after the date of the first publication of this summons, to appear before the court on the day of June, 1909, and defend the above entitled action in the above entitled court and answer the complaint of the plaintiff herein and serve a copy of your answer upon his undersigned. In the case of your answer at his press below stated, and in case of your failure so to do, judgment will be rendered against you according to the demand of the complaint herein which has been filed with the court, in the object of said action, as set forth in the complaint, is to obtain a decree of divorce dissolving the bonds of matrimony now existing between plaintiff and defendant and abandonment and abandonment that has continued for more than six years last past. EDWARD VON TOBEL, Missouri Office; Office and Post Office Address; Rooms 603-5 Mutual Life Building, Seattle, King County, Washington. June 18-July 30, 1909. ORDER TO SHOW CAUSE WHY DIS TRIBUTION SHOULD NOT BE IN THE SUPERIOR COURT OF THE State of Washington, for the County or King, in Probate. In the case of the estate of James Wilbur Jones, Deceased=No. 6771. Wilbur Jones, Deceased.—No. 6771. Amanda L. Jones, wife of the attorney of the case, Wilbur Jones, deceased, having filed in this court her petition setting forth that said estate is now in a condition to be closed and is ready for distribution of the residue therefor among the persons entitled by the court to make payment of the court that said petition sets forth facts sufficient to authorize a distribution of the residue of said estate: It is therefore ordered by the court that all persons interested in the estate of the case, in the case of Wilbur Jones, be and appear before the said Superior Court of King County, State of Washington, at the court room of the Probate department of said court in the county of Seattle, at the court of August, 1909, in the hour of 2:00 of clock p. m. of said day, then and there to show cause, if any they have, why an order of distribution should not be made of the residue of said estate among the heirs and persons in said petition mentioned in the case, be printed and published in said King County and of general circulation therein. Done in open court this 28th day of June, 1909. JOHN B. VAKEY, Judge. State of Washington, County of Kirkland, I. D. K. Sickels, County Clerk of King County and ex-officio Clerk of the Superior Court of the State of Washington, for the County of King, do hereby certify that the foregoing is a full, true and correct copy of an original order to show cause, made by said court on the 28th day of June, 1909, in the matter of the state of James Wilbur Jones, deceased. Witness my hand and the seal of said court this 28th day of June, 1909. D. K. SICKELS, Clerk. (Seal) BY PERCY F. THOMAS, IN THE SUPERIOR COURT OF THE IN THE SUPERIOR COURT OF THE State of Washington for King County. State of Washington for King County. Company, Inc., a corporation, M. P. Randolph, Elizabeth C. Randolph, his wife, M. Finty Investment Company, a corporation, F. J. Herberger and Catherine Herberger, his wife, F. J. Herberger, company, his wife, Orr and N. W. Hamilton, Defendants. No. — — Summons for Publication. The State of Washington to said M. P. Randolph, Elizabeth C. Randolph, his wife, and N. W. Hamilton: the summons to appear within sixty (60) days after date of the first publication of this summons, to- wit: within sixty (60) days after the 30th day of July, 1909, and answer the complaint of the plaintiff and an attorney of the undersigned attorney for plaintiff at his office below stated; and, in case of your failure so to do, judgment will be rendered against you according to the demand of the complaint, which been filed with the mark of said court. The object of this action is to obtain a judgment against the defendants, M. P. Randolph, Elizabeth C. Randolph, his wife, Elizabeth C. Randolph, and the sum of Twenty Thousand dollars with interest thereupon from January 26, 1909, at the rate of seven per cent. per annum, together with an attorney's fee of Two Thousand dollars and cost of the sum of Twenty Thousand dollars Two Hundred Ninety-eight dollars and Seventy-five cents, with interest thereon from the 8th day of July, 1908, at the rate of fifteen per cent. per annum, with certain mortgage given by M. P. Randolph, Elizabeth C. Randolph, his wife, and H. E. Orr Company, Inc., some of the defendants herein, to the plaintiff, A. Smith and C. Smith, corder of Volume 372 of Mortgages at the records of the records of the Auditor's office of the County of King, State of Washington, and which covers the following described property situate in the County of King, State of Washington, Lot 8' in Block 28 of C. D. Boren's Addition to the City of Seattle, King County, Washington, according to the official plat and survey of said land, the office of the Auditor of said King County, Washington, together with the Westerly one-half of that portion of the alley vacated by the City of Seattle, lying Easternly of and adjoining said alley to a footpath of said land for the widening of Fourth Avenue. Said lot being located at the Northeast corner of Fourth Avenue and Cherry Street, Seattle, Washington; together with all and singular the tenements, hereditary and appurtenances thereto beong. And also to sell said premises to satisfy the judgment in plaintiff's complaint prayed for and for general, equitable relief and and for the self and title of foreclosing the rights of all parties hereto in and to said premises and establishing said mortgage to be a priori upon said premises and superior to any and all claims and title of the defendants herein or elsewhere. H. C. RLISE, Attorney for Plaintiff. Postoffice Room: 420 Globe Building, Seattle, King County, Washington. Date: 10-09-10 1999 NOTICE OF SHERIFF'S SALE OF REAL ESTATE. STATE OF WASHINGTON, COUNTY of King, ss.—Sheriff's Office. By virtue of an execution, issued out of the Honorable Superior Court of King County, on the 1st day of July, 1909, by the Clerk thereof, in the case of Margaret C. Dehan (show), plaintiff, versus Annie Andersen, his wife, defendants, No. 67266, and to me, as Sheriff, directed and delivered: Notice is hereby given that I will proceed to sell at public auction to the highest bidder for cash, within the hours prescribed by law for Seattle, to the 11 o'clock m. on the 14th day of August, A. D. 1909, before the court house door of said King County, in the State of Washington, all of the right, title and interest of the said defendant, to the King County delisted property, situated in King County, State of Washington, to-wit; The north half (N. %) of tract twenty-three (23), except the east 340 feet thereof; and the west one are of the south half (S. %) of tract twenty-three (23), section of sixteen (16), a town of twenty-three (24), at least 100 (10), a range for each case W. N.; also 100 (10), a block for by-three (43) of Central Seattle, according to the recorded plat thereof. All of tract twenty-two (22), Spring Hill Villa Tracts, according to the recorded plat thereof in volume 8 of Plats at page 33, a record of 100 units of the range including all second-class tide lands in front of said tract and adjacent to the government meander line, except that portion heretofore conveyed to Samuel W. Fuertel and C. O. Hansen in those two certain deeds of records in volume 541 of the same 449 and 504, Dated 485, respectively, records of said King County, levied on as the property of said defendants, to satisfy a judgment amounting to one hundred forty-nine and $1-100 ($149.81) dollars, and costs of suit, in favor of plaintiff. Dated: CHILDREN DAYS 1909. ROBERT T. HODGE, Sheriff. By BERT C. THOMPSON, Deputy. July 2—July 30, 1909. IN THE SUPERIOR COURT OF THE State of Washington, for King County—In Probate. In the matter of the Estate of Joseph A. Wheeler deceased. No. 10440. Notice to Creditors. By order of said court made herein on the 9th day of July, 1909, notice is hereby given to the creditors of, and to all persons having claims against said deceased or against said deceased with the necessary vouchers to the undersigned, E. L. Park, executor of said estate, at 627 Balley Bldg., the place of business of said estate, in Seattle, in said county and state, within one year from and after the date of first notice of this notice, or same will be barred. Date of first publication, July 30, 1909. A. 627 Bailey Bldg. Seattle, Wash. July 30—August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Stella McMillan, Plaintiff, vs. J. A. McMillan, Defendant. No. — — Summons for Publication. The State of Washington, to J. A. McMillan. You are hereby summoned to appear within sixty (60) days after the date of the first publication of this summons, to-wit, within sixty (60) days after the 23rd day of July, A. D. 1809, and defend the plaintiff, which has been filed with the attempted court and answer the complaint of the plaintiff and serve a copy of your answer upon the undersigned attorney for the plaintiff at his office below stated, and in case of your failure so to do, judgment will be rendered against you according to the demand of the com- plaint, which has been filed with the clerk of said court. This action is instituted by the plaintiff to obtain a divorce from the defendant upon the grounds of non-support and on the further grounds of cruel treatment. JOHN E. RYAN. Attorney for Plaintiff. P. O. Address: 416-20 Globe Building, Seattle, King County, Washington. July 23—Sept. 3, 1909. Phone Main 305 for legal work. NOTICE TO TAXPAYERS. Notice is hereby given that the King County Board of Equalization will be in session three (3) weeks commencing MONDAY, AUGUST 2, 1909, at the King County Court House, for the purpose of equalizing the tax roll of 1909. All tax payers claiming abatement of tax are hereby notified to appear on or before the King County Board of Equalization. SATURDAY, AUGUST 21, 1909, or be forever barred. OTTO A. CASE, County Auditor and Ex-officio Clerk of the Board of County Commissioners of King County, Washington. Julk IN THE SUPERIOR COURT OF THE State of Washington in and for the County of King. In Probate. In the Matter of Guardianship of James Elmer Galloway, Nathan Galloway and Edith Galloway. Nathan Galloway and Edith Galloway's Notice of Sale of Real Estate. Notice is hereby given that under and by virtue of an order of sale in the Superior Court of the State of Washington, I will sell at private sale an undivided three-eighths (%) interest in the following described real estate situate in King County, State of Washington, tow- tits: Lots 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13, Block 18, Salmon Bay Park; Lots 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 and 13, Block 33, Salmon Bay Park; Lots 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 and 12, Block 18, Salmon Bay Park; Lots 6, 7, 8, 9, 10, 11 and 12, Block 180, Salmon Bay Park. The sale will be made on or after the 2nd day of August, 1909. Bids will be received by the undersigned at the office of Life Building, Seattle, Washington. Bids will be received for any number of sald lots collectively, as well as for single lots. Terms of sale are cash, gold coin of the United States; ten per cent. of bid amount, balances to be paid on confirmation of sale by court. Dated this 14th day of July, 1909. D. A. GAILEY, Guardian of the Estate of James Elmer Galley, Lillian Galley and Edith Galley. IN THE SUPERIOR COURT OF THE State of Washington for King County. J. Henry Denning, Plaintiff, vs. J. M. Lathrop, Defendant. No. —. Summons by Publication. The State of Washington, to the said J. M. Lathrop, Defendant: You are hereby summoned to appear within sixty (60) days after the date of the first publication of this summons, to-wit: within sixty (60) days after the date of July 23, 1909 and defend the above entitled action in the above entitled court, and answer the complaint of the Plaintiff, and serve a copy of your answer upon the undersigned attorney for plaintiff, at his office below stated, and in case of your failure to do judge-ment or judgment against you, according to the demand of the complaint, which has been filed with the clerk of said court. The object of the above entitled action is to recover a money judgment against the said defendant in the sum of Five Hundred ($500,000) Dollars. WILLIAM C. KEITH, Attorney for Plaintiff. Office and Post Office Address: 45 Starr-Boyd Bldg., Seattle, Wn. July 23—Sept. 3, 1909. IN THE SUPERIOR COURT OF THE State of Washington, in and for the County of King. Elizabeth A. Chidester, Plaintiff, vs. Justice A. Chidester, Defendant. No. 68906. Summons. The State of Washington to the said Justice A. Chidester, Defendant: You are hereby summoned to appear within sixty days after the date of the first publication of this summons, to-wit, within sixty days after the 23rd day of July, 1909, and defend the above entitled person, the court held to answer the complaint of the plaintiff, and serve a copy of your answer upon the undersigned attorneys for the plaintiff, at their address below stated; and in case of your failure to do so, judgment according to the demand of the complaint to which has been filed with the clerk of said court. The object of said action as set forth in the complaint, is to obtain a decree of divorce dissolving the bonds of matrimony to which the plaintiff and defendant, upon the ground of continued cruel and inhuman treatment of the plaintiff and personal indignities rendering life burdensome, by said defendant. KENNEDY & GILLIS. Attorneys for Plaintiff. Offices and Post Office Address: Rooms 202-3, Bailey Building, Seattle, King County, Washington. IN THE SUPERIOR COURT OF THE State of Washington - in and for the County of King. Magnus Lofquist, Plaintiff, vs. Mary Lofquist, Defendant. No. 68,226. Summons. The state of Washington, to the said Mary Lofquist, Defendant: to appear within sixty days after the date of first publication of this summons, to-wit, within sixty days after the 23rd day of July, 1909, and defend the above entitled action in the above entitled court and the copy of the plaintiff, and serve a copy of your answer the undersigned attorney for the plaintiff, at his office below stated; and in case of your failure so to do, judgment will render payment on according to the demand of the plaintiff, which has been filed with the clerk of said court. The above entitled action is an action for possessing the bonds of matrimony between the marriages hereto on the grounds of cruelty. E. T. SCHOFF. Attorney for Plaintiff. Post Office Address: 503, 504 Pioneer Building, Seattle, King County, Washington. July 23, Sept. 3, 1909. HUMOR OF THE LAW In the court of Circuit Judge Halsey, of Milwaukee, recently a "swift witness" by the name of Stanislaus Komiski was answering questions before they were out of the examiner's mouth. Finally Judge Halsey took a hand. "Are you," he asked, "the same Stanislaus Komiski—" "Yes," broke in the witness, "—who was hung yesterday?" animate other organisms. FRIDAY JULY 30. 1909 There is a lawyer of Cleveland whose quick wit is said never to desert him either in the courtroom or elsewhere. Not long ago a client entered his office and throwing back his coat, exclaimed irritably: "Why, sir, your office is as hot as an oven." "Why shouldn't it be?" asked the lawyer, smilingly. "It's there that I make my bread." At the beginning of last March it was estimated that there were 130,795,927 cotton spindles at work in all the world. Of these the United Kingdom of Great Britain and Ireland had nearly 53,500,000, and the United States a little less than 28,000,000. Of other countries Germany led the list, with almost 10,000,000. In the season of 1907 and 1908 the world furnished a total of 14,307,000 bales of cotton, the American fields furnishing over 12,000,000 bales. How the time flies. Seems only yesterday we obeyed the barber's command to "Sit up straight, please," and then murmured the stereotyped directions, "Short behind—just trim it on top." Heigh ho! The "top" is taking care of itself nowadays. SUMMONS BY PUBLICATION. IN THE SUPERIOR COURT OF THE State of Washington, in and for King County. Domain Starr, Plaintiff, vs. Burgess E Starr, Defendant—No. 67964. The State of Washington to the said Burgess E Starr, Defendant: You are hereby summoned to appear within sixty days after the date of first publication of this summons, to wit, within sixty days after the 2d day of July, 1909, and defend the above en- titled action in the above summons. You are hereby summoned to appear to the undersigned attorney for the plaintiff at his office below stated; and in case of your failure so do you judge- ing, and in case of your action, accord- ing to the demand of the complaint, which has been filed with the clerk of said court. The object of this action is to obtain a decree of divorce from the defendant, and to grant a decree of deferment and non-support, and for the custody of the children of said parties. JOHN R. PARKER. Attorney for Plaintiff. Office and Post Office: Room 8, Union Block, Seattle, Wash. July 2—August 13, 1909. PROBATE NOTICE IN THE SUPERIOR COURT OF THE State of Washington, for the County of King. State of Washington, County of King, ss. In the matter of the estate of James Wilbur Jones, Deceased.—No. 6771. Notice of Settlement of Final Account. Notice is hereby given that Amanda L. Jones, Court of the estate of James Wilbur Jones, deceased, has rendered to and filed in said court her final account as such administratrix, and that Thursday, the 5th day of Aug- ust, 1909, at 2:00 o'clock p. m., at the court room of the probate department of our said Superior Court, in the Suffolk County, has been duly appointed by said court for the sett- ement of said account, at which time and place any person interested in said estate may appear and file his expe- tions in writing to said account, and contest the same. Signed by Hon. John B. Yakey, Judge of said Superior Court, and the seal of said court hereto affixed this 28th day of June, 1909. D. K. SICKELS, Clerk. (Seal) BY PERCY F. THOMAS, Deputy Clerk. July 2—July 30, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County, Aurora Land Company, a corporation, plaintiff, vs. Geo. M. Miller and Jane Doe Miller, his wife, whose true Christian, name is unknown, and all persons unknown, if any, having or claiming an interest in and to the hereinafter described real property, defendants. No. 64710 Washington, To the above de- State of Washington: To the above defendants and each of them: You and each of you, as owners, claimant or holders of an interest or estate in and to the property of the above property are hereby notified that the above named plaintiff is the holder of a certain delinquent tax certificate issued by the treasurer of King County, State of Washington, dated the 27th day of April, 1908, and numbered as follows, for the delinquent taxes of the following year for forgoing amount, and upon the real property situated in said King County described as follows, to-wit: Kirkland, Carmode & Adsit's 1st Add, lot 1, block 24, certificate number B49403, year 1904, amount $1.26. That the taxes for the following prior and subsequent years have been paid by the plaintiff above described real property, to-wit. Lot 1, block 24, Kirkland, Carmode & Adsit's 1st Add: 60 cents for year 1905; 71 cents for year 1906; 87 cents for year 1907; 60 cents for year 1908. Which several sums bear interest at the rate of 10% annum from the unpaid or undredeemed taxes upon and against said real property. You and each of you (including said persons unknown, if any), are hereby further notified and summoned and appear with notice after the unpaid or undredeemed publication of this exclusive of the day of said first publication, to-wit, 60 days after June 11, 1909. in the above entitled court and action; and defend this action and aid and serve a complaint of said and aid on the unpaid or undredeemed attorney for plaintiff in the office below stated or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against, each parcel of said real property, the sums and amounts upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and found against it respectively as found by law and as prayed in plaintiff's complaint, now on file in this cause and court. AURORA LAND COMPANY, Plaintiff. F. J. CARVER. Attorney for Plaintiff. Office Address: Northern Bank and Trust Building. June 11, July 23, 1969. IN THE SUPERIOR COURT OF THE State of Washington for King County, Aurora Land Company, a corporation, plaintiff, vs. Geo. W. Miller and Jane Doe Miller, his wife, whose true Christian name is unknown, and all persons if affidavit or claiming an interest in and to the hereafter described real property, defendants. No. 65511. Notice and Summons. State of Washington: To the above defendants and each of them: You and each of you, as owners claimants or holders of an interest or estate is entitled to the above real property are hereby notified that the above named plaintiff is the holder of two certain delinquent tax certificates issued by the treasurer of King County, State of Washington dated the 27th day of April, 1908, and numbered as follows for the year, 1904. In the following sums, and upon the real property situated in said King County, described as follows, to-wit: Lots two (2) to (four), block twenty-four (24), Carmode & Adsit's 1st Add to Kirkland, lots to 14, block 24, certificate number B49402, year 1904, amount $1.26. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon the above delinquent property to-wit. Lots 2 to 4, Block 24, Carmode & Adsit's 1st Addition to Kirkland, amount 34 cents, for year 1905; amount 47 cents, for year 1906; amount $2.03, for year 1907; amount $2.04, for year 1908; Carmode & Adsit's 1st Addition to Kirkland; amount 69 cents, for year 1905; amount 34 cents, for year 1906; amount $2.03, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from sale of payment, and are all the sums due upon taxes upon and against said real property. You and each of you (including said persons unknown, if any), are hereby further notified and summoned to and apprehended of days after the date of first publication of this notice, exclusive of the day of said first publication, to-wit, sixty days after June 11, 1909. In the above entitled court and action; and defend this action and answer the complaint of said plaintiff in favour of the undersigned attorney for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the late parcel of said real property of the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums and amounts due respectively as provided by law, and as prayed in plaintiff's complaint, *n*w on file in this cause and court. AURORA LAND COMPANY, a Col poration, Plain iff. F. J. CARVER, Attorney for Plaintiff. Office Address: Northern Bank & Trust Co. Bldg. JUNE 11, July 28, 1909. IN THE SUPERIOR COURT OF THE HISTORY State of Washington for King County. Aurora Land Company, a corporation, plaintiff, vs. Unknown Owners, and all persons unknown, if any, having or claiming an interest in and to the certain defendants of the above named tax certificate. No. 64551, Notice and Summons. State of Washington: To the above defendants and each of them: You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter de- fended tax certificate, to the certain defined that the above named plaintiff is the holder of a certain delinquent tax certificate issued by the treasurer of King County, State of Washington, dated the 16th day of September, 1908, and numbered as follows, for the delinquent taxes of the following year, upon the real property situated in said King County, described as follows, to-wit: Kirkland Park Add., lot 48, block 1, certificate number B54318, year 1903, amount 96 cents. What the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, to-wit: Lot 48, block 1, Kirkland Park Add., amount 30 cents, for year 1904; amount 43 cents, for year 1905; amount 53 cents, for year 1906 amount 48 cents, for year 1907. Which several sums bear interest at the rate of 15 per cent, per annum from said date of payment, and are all the unpaid and unredeemed taxes upon and to the landlord. You and each of you (including said persons unknown, if any), are hereby further notified and summoned to be and appear within sixty days after the date of the information of this notice, twelve of the day of said first publication, to-wit, sixty days after June 11, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and serve copy of your information to the assigning attorney for plaintiff at his office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against each said property for the sums and amounts due upon and charged against, each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged each found against respectively as provided, and as presumed in plaintiff's complaint, now on file in this cause and court. AURORA LAND COMPANY, a Corporation. F. I CARYER. Attorney for plaintiff. Office Address: Northern Bank Trust Co. Bldg. IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co., Inc., Plaintiff, vs. Unknown Owners, and all persons unknown, if any, having or claiming an interest in and to the hereinafter described real property, Defendants. No. Notice and Summons. State of Washington: To the above defendants and each of them: You and each of you, as owners, claimants or holders of an estate or estate in addition to an attorney after the above property, are hereby notified that the above named plaintiff is the THE SEATTLE REPUBLICAN holder of a certain delinquent tax cer- tificate issued by the Treasurer of King County, State of Washington, dated the 15th day of January, 1907, and num- bered as follows: the delinquent kni- ses of the following amount, the following amount, and upon the real property situated in said King County, described as follows, to-wit: Atlantic City Addition to Seattle, lot 11, block 10, number B46832, year 1905, amount 92 cents. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, to-wit: Loan to Seattle, 92 cents for year 1906; $ for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from saled date of payment, and are all the taxes upon which the real property against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of publication of any notice exclusive of the day of said first publication, to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and the defendant, foreclosing the lien of said taxes and the undersigned plaintiff at its office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and the undersigned plaintiff at its office below stated, or pay the amount due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and the amount paid, provided by law, and as prayed in plaintiff's complaint, now on file in this cause and Court. SWISS INVESTMENT CO., INC., Plaintiff. Office Address: 457 Arcade Bldg. Seattle. July 16—August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co., Inc., Plaintiff, vs. Unknown Owner, and all persons unknown, if any having any connection to the hereinafter described real property, Defendants. No. .... Notice and Summons. State of Washington: To the above address of the above counsel. You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the owner of the following certificate issued by the Treasurer of King County, State of Washington, dated the 15th day of January, 1907, and numbered as follows, for the delinquent taxes of the for the following year in the paying amount upon the real property situated in said King County, described as follows, to-wit: Southside Garden Tracts, tract 63, certificate number B47828, year 1905; amount $1.43, for year 1906; amount $1.66, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from said date of payment, and are all the taxes on real property taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of publication of the exclusive of the day of said first publication, to-wit, within sixty days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and the undersigned plaintiff at its office below stated, or pay the amount due, together with interest and costs. In case you fall so to do, judgment will be rendered herein, foreclosing the len of said and amount due upon the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the graft and wound against it, specifically as provided by law, and as prayed in plaintiff's complaint, now on file in this cause and Court. SWISS INVESTMENT CO., INC., Plaintiff. Office Address: 457 Arcade Bldg. Seattle. July 16—August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co., Inc., vs. Unknown Owners, and all persons unknown, if any, having or claiming an interest in and to the dereafter described real property Deposits. No. Notice and Summons. State of Washington: To the above State of Washington: To the above defendants and each of them: You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the holder of a certain delinquent tax corp. issued by the State of Washington, the County, State of Washington, dated the 17th day of January, 1907, and numbered as follows, for the delinquent taxes of the following year, in the following amount, and upon the real property situated in said King County, designated for the Ballard Addition to Seattle. The Ballard Addition to Seattle, lot 46 (less west 21 ft.), block 1, certificate number B46926, year 1905, amount $2.71. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, for year 1906; amount 17 cents, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from the date of the filing of the unpaid and unredeemed taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of publication of this exclusive of the day of said first publication, to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff to the undersigned plaintiff at its office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and providing real property for the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and against it, and provided by law and as prayed in plaintiffs complaint, now on file in this cause and Court. SWISS INVESTMENT CO. INC., Plaintiff Office Address: 457 Arcade Bldg., Seattle July 16—August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Washington, Oystercatcher known Owney, and all persons unknown, if any, having or claiming an interest in and to the hereinafter described real property. Defendants. No. Oystercatcher Supported. State of Washington: To the above defendants and coah of them; You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the owner of the property, and the certificate issued by the Treasurer of King County, State of Washington, dated the 17th day of January, 1907, and numbered as follows, for the delinquent taxes of the following year, in the property situated in said King County, described as follows, to-wit: The Ballard Addition to Seattle, lot number $46277, year 1996, amount $2,42. Lot 47 (less west 12 ft.), block 1, The Ballard Addition to Seattle, amount 89 cents, for year 1906 amount $1.02, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from sale date of payment, and are all the sales of property taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of first publication of this notice. Exclusive of the day of said first publication, to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and to the limitation of said plaintiff and serve a copy of your answer on the undersigned plaintiff at its office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against each parcel of said real property for the sums and amounts due upon and charged against each, said taxes, interest and costs, ordering a sale of each parcel of said property for the satisfaction of the sums charged and found against it respectively as provided by law, and as prayed in plaintiff's complaint, now on file in this cause and Court. SWISS INVESTMENT CO., INC. Office Address: 457 Arcade Bldg. Seattle, Wash. July 16, 1909 IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co., Inc., Plaintiff. vs. Unknown Owners, and all persons unknown, if any, having or claiming an interest in and to the hereinafter described real property, Defendants. No. ..... Notice and Summons. State of Washington: To the above defendants and each of them: You and each of you, as owners, claimants or holders of an interest or estate in the real property, are hereby notified that the above named plaintiff is the holder of a certain delinquent tax certificate-issued by the Treasurer of King County, State of Washington, dated the 15th day of January 1906, paid as follows for the delinquent taxes of the following year, in the following amount, and upon the real property situated in said King County, described as follows, to-wit: Southside Garden Tracts, tract 70, county number B47829, year 1905, amount $1.99. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described property, tract 70, Southside Garden Tracts, amount $1.43, for year 1906; amount $1.66, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from sale date, payment and are all the greatest and unpaid taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of first publication of this notice, execute the bill of sale, obtain a court order to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and serve a copy of your answer on the undersigned plaintiff at its office below stated, or pay the amount due, when such payment is made, and case fall so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against each parcel of said real property for the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering the satisfaction of the sums charged for the satisfaction of the sums charged and found against it respectively as provided by law, and as prayed in plaintiff's complaint, now on fine in this cause and Court. SWISS INVESTMENT CO., INC. Plaintiff Office Address: 457 Arcade Bldg. Seattle, Wash. July 16-August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County, Swiss Investment Co., Inc. Plaintiff, vs. Unknown Owners, and all persons unknown, if any, having or claiming an interest in and to the hereinafter described real property, Defendants. No. Notice and Summons. State of Washington: To the above defendants and each of them: You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the holder of a certain delinquent tax certificate, issued by King County, State of Washington, dated the 17th day of January, 1907, and numbered as follows, for the delinquent taxes of the following year, in the following amount, and upon the real property situated in said King County, deferred from the Ballard Addition to Seattle, The Ballard Addition to Seattle, lot 48 (less west 9 ft.), block 1, certificate number B46928, year 1905, amount $2.32. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said deferred lot. Lot 48 (less west 9 ft.), block 1, The Ballard Addition to Seattle, amount $1.18, for year 1906; amount $1.68, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from said date of payment, and are all the sums paid in taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified, and summoned to the office upon request after the date of first publication of this notice, exclusive of the day of said first publication, to-wit, within 60 days after July 1, 2014, to give the notice of action; and defend this action and answer the complaint of said plaintiff and serve a copy of your answer on the undersigned plaintiff at its office below stated interest and costs. In case fall so to do, judgment will be rendered herein, foreclosing the lien of sald taxes and costs against each parcel of sald real property for the sums charged due upon and charged against each, for sald taxes, interest and costs, ordering a sale of each parcel of sald property for the satisfaction of the sums charged due upon and charged against it respectively is provided by law, and as prayed in plaintiff's complaint, now on file in this cause and Court. SWISS INVESTMENT CO., INC. Plaintiff. Office Address: 457 Arcade Bldg. Seattle, Wash. July 16-August 27, 1909. IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co. Inc., Plaintiff, v. Unknown Owner, v. persons unknown if any having or claiming an interest in and to the hereinafter described real property, Defendants. No. .... Notice and Summons. State of Washington: To the above of the You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified that the above named plaintiff is the owner of the following year, in the filing of the certificate issued by the Treasurer of King County, State of Washington, dated the 17th day of January, 1907, and numbered as follows, for the delinquent taxes of the following year, in the filing of the certificate issued by the Treasurer of King County, described as follows, to-wit: West Seattle, Southern Pacific Supplemental Addition, west 55 ft, of lot 20, block 3, certificate number B47633, and finally, block 3. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, to-wit: West Seattle, Southern Pacific Supplemental Addition, amount 42 cents, for year 1906; amount 54 cents, for year 1907. Which several sums bear interest at the rate of 15 per cent, per annum from said date of payment, and are all the unpaid taxes upon taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of first publication of the exclusive of the day of said first publication, to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and hold the plaintiff against the undersigned plaintiff at its office below stated, or pay the amount due, together with interest and costs. In case you fail so to do, judgment will be rendered herein, foreclosing the lien of said taxes and costs against each parcel of said taxes and found against it respectively as provided by law, and as prayed in plaintiff's complaint, now on file in this cause and Court. SWISS INVESTMENT CO., INC. Plaintiff Office Address: 457 Arcade Bld. Seattle, Wash. will be dated July 16, 1909 IN THE SUPERIOR COURT OF THE State of Washington for King County. Swiss Investment Co., Inc., Plaintiff, v. Washington, for the claim of unknown, if any, having or claiming an interest in and to the hereafter described real property, Defendants. No. Notice and Summons. State of Washington. To the above defendants, in addition of the You and each of you, as owners, claimants or holders of an interest or estate in and to the hereinafter described real property, are hereby notified of the tax certificate issued by the Treasurer of King County, State of Washington, dated the 17th day of January, 1909, and numbered as follows, for the delinquent tax on the king's property in the following amount, and upon the real property situated in said King County, described as follows, to-wit: Ballard Park Addition, lot 42, block 11, numbered B472720, year 1905, amount $1.36. That the taxes for the following prior and subsequent years have been paid by the plaintiff upon said above described real property, to-wit: Ballard Park Addition, amount $1.78, for year 1906; amount $2.03, for year 1907. Which several sums bear interest at the rate of 15 per cent. per annum from sale date and payment, and are all the amount and taxes upon and against said real property. You and each of you (including said persons unknown, if any) are hereby further notified and summoned to be and appear within sixty days after the date of your filing of this complaint, exclusive of the day of said first publication, to-wit, within 60 days after July 16, 1909, in the above entitled court and action; and defend this action and answer the complaint of said plaintiff and secretrer from the day of your filing of this complaint, at its office below stated, or pay the amount due, together with interest and costs. In case you fall so to do, judgment will be rendered herein, foreclosing the lien of said taxes and real property for the sums and amounts due upon and charged against each, for said taxes, interest and costs, ordering a sale of each parcel of said property the satisfaction of the sums charged and against it, respectively as provided by law, and as prayed in plaintiff's complaint now on file in this cause and Court. SWISS INVESTMENT CO., INC., Plaintiff. Office Address: 457 Arcade Bldg., Seattle, Wash. July 16—August 27, 1909. SUMMONS. IN THE SUPERIOR COURT OF THE State of Washington in and for King County. Alexander W. Teel, Plaintiff, vs. Catherine Teel, Defendant. No. — The State of Washington to Catherine Teel, defendant: You are hereby summoned to appear within sixty (60) days after the first publication of this summons, to-wit: within sixty (60) days after the 16th anniversary of 1900 and defend the above entitled action, in the court of the supreme court, and answer the complaint of the plaintiff and serve a copy of your answer on the undersigned attorney for the plaintiff, at his office below stated: and in case of your failure so to do with the plaintiff rendered against you according to the demand of the court plaintiff which has been filed with the clerk of said court. The object of this action is to obtain a decree of divorce by plaintiff from defendant, on the grounds of desertion of the defendant of plaintiff, without cause, for more than a year, and to award to plaintiff the care and custody of George Teel, the minor child of plaintiff and defendant. Attorney for Plaintiff. Office and Postoffice address: No. 514 Marion Bldg., Seattle, Wash. July 16-August 27, 1909. FRIDAY, JULY 16, 1909 THE SEATTLE REPUBLICAN Well, HereWeAre The SEATTLE REPUBLICAN NORTHWEST NEGRO PROGRESS NUMBER Get me at 307 Eppler Block, or at Tutt's Barber Shop, 306 Main St., Seattle, Wash. Six Cts. Takes Me Away